Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	6844
Gene name	Vesicle associated membrane protein 2
Gene symbol	VAMP2
Synonyms (NCBI Gene)	NEDHAHMSYB2VAMP-2
Chromosome	17
Chromosome location	17p13.1
Summary	The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involve

SNP ID	Visualize variation	Clinical significance	Consequence
rs1598265382	T>G	Pathogenic	Missense variant, coding sequence variant
rs1598265384	A>G	Pathogenic	Missense variant, coding sequence variant
rs1598265387	A>G	Pathogenic	Missense variant, coding sequence variant
rs1598265438	ATG>-	Pathogenic	Inframe deletion, coding sequence variant
rs1598265441	ACC>-	Pathogenic	Coding sequence variant, splice acceptor variant

435 Show/Hide all (435)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001758	hsa-miR-34a-5p	Luciferase reporter assay	14697198
MIRT051508	hsa-let-7e-5p	CLASH	23622248
MIRT437775	hsa-miR-206	Luciferase reporter assay	25481410
MIRT437775	hsa-miR-206	Luciferase reporter assay	25481410
MIRT437775	hsa-miR-206	Luciferase reporter assay	25481410
MIRT437775	hsa-miR-206	Luciferase reporter assay	25481410
MIRT437775	hsa-miR-206	Luciferase reporter assay	25481410
MIRT437775	hsa-miR-206	Luciferase reporter assay	25481410
MIRT1481640	hsa-miR-1	CLIP-seq
MIRT1481641	hsa-miR-127-3p	CLIP-seq
MIRT1481642	hsa-miR-1275	CLIP-seq
MIRT1481643	hsa-miR-1287	CLIP-seq
MIRT1481644	hsa-miR-1321	CLIP-seq
MIRT1481645	hsa-miR-133a	CLIP-seq
MIRT1481646	hsa-miR-133b	CLIP-seq
MIRT1481647	hsa-miR-135a	CLIP-seq
MIRT1481648	hsa-miR-135b	CLIP-seq
MIRT1481649	hsa-miR-150	CLIP-seq
MIRT1481650	hsa-miR-1911	CLIP-seq
MIRT1481651	hsa-miR-223	CLIP-seq
MIRT1481652	hsa-miR-296-3p	CLIP-seq
MIRT1481653	hsa-miR-3117-3p	CLIP-seq
MIRT1481654	hsa-miR-3135b	CLIP-seq
MIRT1481655	hsa-miR-3143	CLIP-seq
MIRT1481656	hsa-miR-3150a-3p	CLIP-seq
MIRT1481657	hsa-miR-3151	CLIP-seq
MIRT1481658	hsa-miR-3162-5p	CLIP-seq
MIRT1481659	hsa-miR-3175	CLIP-seq
MIRT1481660	hsa-miR-3189-3p	CLIP-seq
MIRT1481661	hsa-miR-337-5p	CLIP-seq
MIRT1481662	hsa-miR-342-5p	CLIP-seq
MIRT1481663	hsa-miR-3612	CLIP-seq
MIRT1481664	hsa-miR-3622b-5p	CLIP-seq
MIRT1481665	hsa-miR-3928	CLIP-seq
MIRT1481666	hsa-miR-4253	CLIP-seq
MIRT1481667	hsa-miR-4271	CLIP-seq
MIRT1481668	hsa-miR-4320	CLIP-seq
MIRT1481669	hsa-miR-4447	CLIP-seq
MIRT1481670	hsa-miR-4470	CLIP-seq
MIRT1481671	hsa-miR-4472	CLIP-seq
MIRT1481672	hsa-miR-4475	CLIP-seq
MIRT1481673	hsa-miR-4481	CLIP-seq
MIRT1481674	hsa-miR-4488	CLIP-seq
MIRT1481675	hsa-miR-450b-3p	CLIP-seq
MIRT1481676	hsa-miR-4525	CLIP-seq
MIRT1481677	hsa-miR-4640-5p	CLIP-seq
MIRT1481678	hsa-miR-4651	CLIP-seq
MIRT1481679	hsa-miR-4656	CLIP-seq
MIRT1481680	hsa-miR-4664-5p	CLIP-seq
MIRT1481681	hsa-miR-4665-5p	CLIP-seq
MIRT1481682	hsa-miR-4667-5p	CLIP-seq
MIRT1481683	hsa-miR-4685-5p	CLIP-seq
MIRT1481684	hsa-miR-4697-3p	CLIP-seq
MIRT1481685	hsa-miR-4697-5p	CLIP-seq
MIRT1481686	hsa-miR-4699-3p	CLIP-seq
MIRT1481687	hsa-miR-4700-5p	CLIP-seq
MIRT1481688	hsa-miR-4716-3p	CLIP-seq
MIRT1481689	hsa-miR-4723-5p	CLIP-seq
MIRT1481690	hsa-miR-4725-3p	CLIP-seq
MIRT1481691	hsa-miR-4726-5p	CLIP-seq
MIRT1481692	hsa-miR-4739	CLIP-seq
MIRT1481693	hsa-miR-4745-5p	CLIP-seq
MIRT1481694	hsa-miR-4756-5p	CLIP-seq
MIRT1481695	hsa-miR-4766-5p	CLIP-seq
MIRT1481696	hsa-miR-4782-5p	CLIP-seq
MIRT1481697	hsa-miR-4787-3p	CLIP-seq
MIRT1481698	hsa-miR-4795-5p	CLIP-seq
MIRT1481699	hsa-miR-5095	CLIP-seq
MIRT1481700	hsa-miR-5096	CLIP-seq
MIRT1481701	hsa-miR-513b	CLIP-seq
MIRT1481702	hsa-miR-548a-3p	CLIP-seq
MIRT1481703	hsa-miR-548e	CLIP-seq
MIRT1481704	hsa-miR-548f	CLIP-seq
MIRT1481705	hsa-miR-555	CLIP-seq
MIRT1481706	hsa-miR-570	CLIP-seq
MIRT1481707	hsa-miR-608	CLIP-seq
MIRT1481708	hsa-miR-613	CLIP-seq
MIRT1481709	hsa-miR-625	CLIP-seq
MIRT1481710	hsa-miR-650	CLIP-seq
MIRT1481711	hsa-miR-765	CLIP-seq
MIRT1481712	hsa-miR-769-3p	CLIP-seq
MIRT1481713	hsa-miR-939	CLIP-seq
MIRT1481714	hsa-miR-944	CLIP-seq
MIRT2144887	hsa-miR-1207-3p	CLIP-seq
MIRT2144888	hsa-miR-1207-5p	CLIP-seq
MIRT1481642	hsa-miR-1275	CLIP-seq
MIRT2144889	hsa-miR-1909	CLIP-seq
MIRT2144890	hsa-miR-3148	CLIP-seq
MIRT2144891	hsa-miR-3179	CLIP-seq
MIRT2144892	hsa-miR-3184	CLIP-seq
MIRT2144893	hsa-miR-338-3p	CLIP-seq
MIRT2144894	hsa-miR-3646	CLIP-seq
MIRT2144895	hsa-miR-3662	CLIP-seq
MIRT2144896	hsa-miR-3664-3p	CLIP-seq
MIRT2144897	hsa-miR-3941	CLIP-seq
MIRT2144898	hsa-miR-3978	CLIP-seq
MIRT2144899	hsa-miR-423-5p	CLIP-seq
MIRT2144900	hsa-miR-4286	CLIP-seq
MIRT2144901	hsa-miR-4419a	CLIP-seq
MIRT2144902	hsa-miR-4464	CLIP-seq
MIRT1481672	hsa-miR-4475	CLIP-seq
MIRT2144903	hsa-miR-4510	CLIP-seq
MIRT1481676	hsa-miR-4525	CLIP-seq
MIRT1481681	hsa-miR-4665-5p	CLIP-seq
MIRT1481682	hsa-miR-4667-5p	CLIP-seq
MIRT1481687	hsa-miR-4700-5p	CLIP-seq
MIRT1481689	hsa-miR-4723-5p	CLIP-seq
MIRT2144904	hsa-miR-4728-5p	CLIP-seq
MIRT2144905	hsa-miR-4729	CLIP-seq
MIRT2144906	hsa-miR-4731-5p	CLIP-seq
MIRT2144907	hsa-miR-4748	CLIP-seq
MIRT2144908	hsa-miR-4756-3p	CLIP-seq
MIRT2144909	hsa-miR-4763-3p	CLIP-seq
MIRT2144910	hsa-miR-4779	CLIP-seq
MIRT1481696	hsa-miR-4782-5p	CLIP-seq
MIRT1481697	hsa-miR-4787-3p	CLIP-seq
MIRT1481700	hsa-miR-5096	CLIP-seq
MIRT1481701	hsa-miR-513b	CLIP-seq
MIRT1481705	hsa-miR-555	CLIP-seq
MIRT1481709	hsa-miR-625	CLIP-seq
MIRT2144911	hsa-miR-634	CLIP-seq
MIRT2144912	hsa-miR-637	CLIP-seq
MIRT2144913	hsa-miR-940	CLIP-seq
MIRT2144888	hsa-miR-1207-5p	CLIP-seq
MIRT1481641	hsa-miR-127-3p	CLIP-seq
MIRT1481642	hsa-miR-1275	CLIP-seq
MIRT2365305	hsa-miR-1285	CLIP-seq
MIRT1481647	hsa-miR-135a	CLIP-seq
MIRT1481648	hsa-miR-135b	CLIP-seq
MIRT1481649	hsa-miR-150	CLIP-seq
MIRT2144889	hsa-miR-1909	CLIP-seq
MIRT2365306	hsa-miR-1910	CLIP-seq
MIRT1481653	hsa-miR-3117-3p	CLIP-seq
MIRT2144890	hsa-miR-3148	CLIP-seq
MIRT1481657	hsa-miR-3151	CLIP-seq
MIRT2144891	hsa-miR-3179	CLIP-seq
MIRT2365307	hsa-miR-3187-5p	CLIP-seq
MIRT2365308	hsa-miR-3202	CLIP-seq
MIRT2365309	hsa-miR-34a	CLIP-seq
MIRT2365310	hsa-miR-34c-5p	CLIP-seq
MIRT2365311	hsa-miR-3675-5p	CLIP-seq
MIRT2365312	hsa-miR-3689a-3p	CLIP-seq
MIRT2365313	hsa-miR-3689c	CLIP-seq
MIRT2365314	hsa-miR-3936	CLIP-seq
MIRT2365315	hsa-miR-4257	CLIP-seq
MIRT2365316	hsa-miR-4269	CLIP-seq
MIRT2365317	hsa-miR-4277	CLIP-seq
MIRT2144900	hsa-miR-4286	CLIP-seq
MIRT1481668	hsa-miR-4320	CLIP-seq
MIRT2365318	hsa-miR-4330	CLIP-seq
MIRT2144901	hsa-miR-4419a	CLIP-seq
MIRT1481669	hsa-miR-4447	CLIP-seq
MIRT1481671	hsa-miR-4472	CLIP-seq
MIRT2365319	hsa-miR-4476	CLIP-seq
MIRT2365320	hsa-miR-4477b	CLIP-seq
MIRT1481673	hsa-miR-4481	CLIP-seq
MIRT2365321	hsa-miR-4487	CLIP-seq
MIRT1481674	hsa-miR-4488	CLIP-seq
MIRT2365322	hsa-miR-449a	CLIP-seq
MIRT2365323	hsa-miR-449b	CLIP-seq
MIRT1481675	hsa-miR-450b-3p	CLIP-seq
MIRT2144903	hsa-miR-4510	CLIP-seq
MIRT2365324	hsa-miR-4514	CLIP-seq
MIRT1481676	hsa-miR-4525	CLIP-seq
MIRT2365325	hsa-miR-4539	CLIP-seq
MIRT2365326	hsa-miR-455-3p	CLIP-seq
MIRT1481677	hsa-miR-4640-5p	CLIP-seq
MIRT1481679	hsa-miR-4656	CLIP-seq
MIRT1481681	hsa-miR-4665-5p	CLIP-seq
MIRT1481683	hsa-miR-4685-5p	CLIP-seq
MIRT2365327	hsa-miR-4692	CLIP-seq
MIRT2365328	hsa-miR-4694-5p	CLIP-seq
MIRT1481685	hsa-miR-4697-5p	CLIP-seq
MIRT1481686	hsa-miR-4699-3p	CLIP-seq
MIRT2365329	hsa-miR-4712-3p	CLIP-seq
MIRT1481688	hsa-miR-4716-3p	CLIP-seq
MIRT1481689	hsa-miR-4723-5p	CLIP-seq
MIRT2365330	hsa-miR-4724-5p	CLIP-seq
MIRT1481691	hsa-miR-4726-5p	CLIP-seq
MIRT2144904	hsa-miR-4728-5p	CLIP-seq
MIRT2365331	hsa-miR-4742-5p	CLIP-seq
MIRT1481693	hsa-miR-4745-5p	CLIP-seq
MIRT2144909	hsa-miR-4763-3p	CLIP-seq
MIRT1481695	hsa-miR-4766-5p	CLIP-seq
MIRT2365332	hsa-miR-4772-5p	CLIP-seq
MIRT2144910	hsa-miR-4779	CLIP-seq
MIRT2365333	hsa-miR-4803	CLIP-seq
MIRT2365334	hsa-miR-486-3p	CLIP-seq
MIRT1481699	hsa-miR-5095	CLIP-seq
MIRT1481701	hsa-miR-513b	CLIP-seq
MIRT2365335	hsa-miR-548c-3p	CLIP-seq
MIRT2365336	hsa-miR-603	CLIP-seq
MIRT2365337	hsa-miR-609	CLIP-seq
MIRT2365338	hsa-miR-612	CLIP-seq
MIRT1481709	hsa-miR-625	CLIP-seq
MIRT1481711	hsa-miR-765	CLIP-seq
MIRT1481712	hsa-miR-769-3p	CLIP-seq
MIRT2144887	hsa-miR-1207-3p	CLIP-seq
MIRT1481642	hsa-miR-1275	CLIP-seq
MIRT2144891	hsa-miR-3179	CLIP-seq
MIRT1481676	hsa-miR-4525	CLIP-seq
MIRT1481681	hsa-miR-4665-5p	CLIP-seq
MIRT1481688	hsa-miR-4716-3p	CLIP-seq
MIRT1481689	hsa-miR-4723-5p	CLIP-seq
MIRT2144910	hsa-miR-4779	CLIP-seq
MIRT1481709	hsa-miR-625	CLIP-seq
MIRT1481641	hsa-miR-127-3p	CLIP-seq
MIRT1481669	hsa-miR-4447	CLIP-seq
MIRT1481671	hsa-miR-4472	CLIP-seq
MIRT1481673	hsa-miR-4481	CLIP-seq
MIRT1481674	hsa-miR-4488	CLIP-seq
MIRT1481679	hsa-miR-4656	CLIP-seq
MIRT1481683	hsa-miR-4685-5p	CLIP-seq
MIRT1481685	hsa-miR-4697-5p	CLIP-seq
MIRT1481693	hsa-miR-4745-5p	CLIP-seq
MIRT1481695	hsa-miR-4766-5p	CLIP-seq
MIRT1481641	hsa-miR-127-3p	CLIP-seq
MIRT1481669	hsa-miR-4447	CLIP-seq
MIRT1481671	hsa-miR-4472	CLIP-seq
MIRT1481673	hsa-miR-4481	CLIP-seq
MIRT1481683	hsa-miR-4685-5p	CLIP-seq
MIRT1481693	hsa-miR-4745-5p	CLIP-seq
MIRT2144888	hsa-miR-1207-5p	CLIP-seq
MIRT2659049	hsa-miR-1251	CLIP-seq
MIRT2659050	hsa-miR-1253	CLIP-seq
MIRT1481641	hsa-miR-127-3p	CLIP-seq
MIRT1481642	hsa-miR-1275	CLIP-seq
MIRT2365305	hsa-miR-1285	CLIP-seq
MIRT1481643	hsa-miR-1287	CLIP-seq
MIRT1481647	hsa-miR-135a	CLIP-seq
MIRT1481648	hsa-miR-135b	CLIP-seq
MIRT1481649	hsa-miR-150	CLIP-seq
MIRT2144889	hsa-miR-1909	CLIP-seq
MIRT2365306	hsa-miR-1910	CLIP-seq
MIRT2659051	hsa-miR-1976	CLIP-seq
MIRT2659052	hsa-miR-2110	CLIP-seq
MIRT2659053	hsa-miR-214	CLIP-seq
MIRT2659054	hsa-miR-2682	CLIP-seq
MIRT2659055	hsa-miR-28-5p	CLIP-seq
MIRT1481652	hsa-miR-296-3p	CLIP-seq
MIRT1481653	hsa-miR-3117-3p	CLIP-seq
MIRT2659056	hsa-miR-3127-5p	CLIP-seq
MIRT2659057	hsa-miR-3134	CLIP-seq
MIRT1481654	hsa-miR-3135b	CLIP-seq
MIRT2659058	hsa-miR-3139	CLIP-seq
MIRT1481655	hsa-miR-3143	CLIP-seq
MIRT1481656	hsa-miR-3150a-3p	CLIP-seq
MIRT1481657	hsa-miR-3151	CLIP-seq
MIRT2659059	hsa-miR-3165	CLIP-seq
MIRT1481659	hsa-miR-3175	CLIP-seq
MIRT2365307	hsa-miR-3187-5p	CLIP-seq
MIRT1481660	hsa-miR-3189-3p	CLIP-seq
MIRT1481661	hsa-miR-337-5p	CLIP-seq
MIRT2659060	hsa-miR-342-3p	CLIP-seq
MIRT2365309	hsa-miR-34a	CLIP-seq
MIRT2365310	hsa-miR-34c-5p	CLIP-seq
MIRT2659061	hsa-miR-361-3p	CLIP-seq
MIRT2659062	hsa-miR-3619-5p	CLIP-seq
MIRT2365311	hsa-miR-3675-5p	CLIP-seq
MIRT2659063	hsa-miR-3688-3p	CLIP-seq
MIRT2365312	hsa-miR-3689a-3p	CLIP-seq
MIRT2365313	hsa-miR-3689c	CLIP-seq
MIRT2659064	hsa-miR-3689d	CLIP-seq
MIRT2659065	hsa-miR-380	CLIP-seq
MIRT2659066	hsa-miR-3926	CLIP-seq
MIRT1481665	hsa-miR-3928	CLIP-seq
MIRT2144898	hsa-miR-3978	CLIP-seq
MIRT2365315	hsa-miR-4257	CLIP-seq
MIRT2365316	hsa-miR-4269	CLIP-seq
MIRT2659067	hsa-miR-4274	CLIP-seq
MIRT2659068	hsa-miR-4316	CLIP-seq
MIRT1481668	hsa-miR-4320	CLIP-seq
MIRT2659069	hsa-miR-4436b-3p	CLIP-seq
MIRT1481669	hsa-miR-4447	CLIP-seq
MIRT2659070	hsa-miR-4456	CLIP-seq
MIRT2659071	hsa-miR-4457	CLIP-seq
MIRT1481671	hsa-miR-4472	CLIP-seq
MIRT2659072	hsa-miR-4474-3p	CLIP-seq
MIRT1481673	hsa-miR-4481	CLIP-seq
MIRT2365321	hsa-miR-4487	CLIP-seq
MIRT1481674	hsa-miR-4488	CLIP-seq
MIRT2659073	hsa-miR-4495	CLIP-seq
MIRT2365322	hsa-miR-449a	CLIP-seq
MIRT2365323	hsa-miR-449b	CLIP-seq
MIRT2659074	hsa-miR-449c	CLIP-seq
MIRT1481675	hsa-miR-450b-3p	CLIP-seq
MIRT2365324	hsa-miR-4514	CLIP-seq
MIRT2659075	hsa-miR-4519	CLIP-seq
MIRT1481676	hsa-miR-4525	CLIP-seq
MIRT2659076	hsa-miR-4530	CLIP-seq
MIRT2659077	hsa-miR-4534	CLIP-seq
MIRT2365326	hsa-miR-455-3p	CLIP-seq
MIRT2659078	hsa-miR-4640-3p	CLIP-seq
MIRT1481677	hsa-miR-4640-5p	CLIP-seq
MIRT1481679	hsa-miR-4656	CLIP-seq
MIRT1481681	hsa-miR-4665-5p	CLIP-seq
MIRT2659079	hsa-miR-4684-5p	CLIP-seq
MIRT1481683	hsa-miR-4685-5p	CLIP-seq
MIRT2365327	hsa-miR-4692	CLIP-seq
MIRT2659080	hsa-miR-4694-3p	CLIP-seq
MIRT1481685	hsa-miR-4697-5p	CLIP-seq
MIRT2659081	hsa-miR-4710	CLIP-seq
MIRT1481689	hsa-miR-4723-5p	CLIP-seq
MIRT1481691	hsa-miR-4726-5p	CLIP-seq
MIRT2144904	hsa-miR-4728-5p	CLIP-seq
MIRT2365331	hsa-miR-4742-5p	CLIP-seq
MIRT1481693	hsa-miR-4745-5p	CLIP-seq
MIRT2144908	hsa-miR-4756-3p	CLIP-seq
MIRT2144909	hsa-miR-4763-3p	CLIP-seq
MIRT2659082	hsa-miR-4764-3p	CLIP-seq
MIRT2659083	hsa-miR-4765	CLIP-seq
MIRT1481695	hsa-miR-4766-5p	CLIP-seq
MIRT2659084	hsa-miR-4771	CLIP-seq
MIRT2365332	hsa-miR-4772-5p	CLIP-seq
MIRT2144910	hsa-miR-4779	CLIP-seq
MIRT2659085	hsa-miR-4797-3p	CLIP-seq
MIRT2365334	hsa-miR-486-3p	CLIP-seq
MIRT1481701	hsa-miR-513b	CLIP-seq
MIRT2659086	hsa-miR-541	CLIP-seq
MIRT2659087	hsa-miR-542-5p	CLIP-seq
MIRT2659088	hsa-miR-548s	CLIP-seq
MIRT2365336	hsa-miR-603	CLIP-seq
MIRT2365338	hsa-miR-612	CLIP-seq
MIRT1481709	hsa-miR-625	CLIP-seq
MIRT2659089	hsa-miR-645	CLIP-seq
MIRT2659090	hsa-miR-654-5p	CLIP-seq
MIRT2659091	hsa-miR-663b	CLIP-seq
MIRT2659092	hsa-miR-708	CLIP-seq
MIRT2659093	hsa-miR-761	CLIP-seq
MIRT1481711	hsa-miR-765	CLIP-seq
MIRT1481712	hsa-miR-769-3p	CLIP-seq
MIRT1481713	hsa-miR-939	CLIP-seq
MIRT2144913	hsa-miR-940	CLIP-seq
MIRT2659094	hsa-miR-942	CLIP-seq
MIRT2144888	hsa-miR-1207-5p	CLIP-seq
MIRT2659049	hsa-miR-1251	CLIP-seq
MIRT2659050	hsa-miR-1253	CLIP-seq
MIRT1481641	hsa-miR-127-3p	CLIP-seq
MIRT1481642	hsa-miR-1275	CLIP-seq
MIRT2365305	hsa-miR-1285	CLIP-seq
MIRT1481643	hsa-miR-1287	CLIP-seq
MIRT1481647	hsa-miR-135a	CLIP-seq
MIRT1481648	hsa-miR-135b	CLIP-seq
MIRT1481649	hsa-miR-150	CLIP-seq
MIRT2144889	hsa-miR-1909	CLIP-seq
MIRT2365306	hsa-miR-1910	CLIP-seq
MIRT2659051	hsa-miR-1976	CLIP-seq
MIRT2659052	hsa-miR-2110	CLIP-seq
MIRT2659053	hsa-miR-214	CLIP-seq
MIRT2659054	hsa-miR-2682	CLIP-seq
MIRT2659055	hsa-miR-28-5p	CLIP-seq
MIRT1481652	hsa-miR-296-3p	CLIP-seq
MIRT2659056	hsa-miR-3127-5p	CLIP-seq
MIRT2659057	hsa-miR-3134	CLIP-seq
MIRT1481654	hsa-miR-3135b	CLIP-seq
MIRT2659058	hsa-miR-3139	CLIP-seq
MIRT1481655	hsa-miR-3143	CLIP-seq
MIRT1481656	hsa-miR-3150a-3p	CLIP-seq
MIRT2659059	hsa-miR-3165	CLIP-seq
MIRT1481659	hsa-miR-3175	CLIP-seq
MIRT2365307	hsa-miR-3187-5p	CLIP-seq
MIRT1481660	hsa-miR-3189-3p	CLIP-seq
MIRT1481661	hsa-miR-337-5p	CLIP-seq
MIRT2659060	hsa-miR-342-3p	CLIP-seq
MIRT2365309	hsa-miR-34a	CLIP-seq
MIRT2365310	hsa-miR-34c-5p	CLIP-seq
MIRT2659061	hsa-miR-361-3p	CLIP-seq
MIRT2659062	hsa-miR-3619-5p	CLIP-seq
MIRT2365311	hsa-miR-3675-5p	CLIP-seq
MIRT2659063	hsa-miR-3688-3p	CLIP-seq
MIRT2365312	hsa-miR-3689a-3p	CLIP-seq
MIRT2365313	hsa-miR-3689c	CLIP-seq
MIRT2659064	hsa-miR-3689d	CLIP-seq
MIRT2659066	hsa-miR-3926	CLIP-seq
MIRT1481665	hsa-miR-3928	CLIP-seq
MIRT2144898	hsa-miR-3978	CLIP-seq
MIRT2365315	hsa-miR-4257	CLIP-seq
MIRT2365316	hsa-miR-4269	CLIP-seq
MIRT2659067	hsa-miR-4274	CLIP-seq
MIRT2659069	hsa-miR-4436b-3p	CLIP-seq
MIRT1481669	hsa-miR-4447	CLIP-seq
MIRT2659070	hsa-miR-4456	CLIP-seq
MIRT2659071	hsa-miR-4457	CLIP-seq
MIRT1481671	hsa-miR-4472	CLIP-seq
MIRT2659072	hsa-miR-4474-3p	CLIP-seq
MIRT1481673	hsa-miR-4481	CLIP-seq
MIRT2365321	hsa-miR-4487	CLIP-seq
MIRT1481674	hsa-miR-4488	CLIP-seq
MIRT2365322	hsa-miR-449a	CLIP-seq
MIRT2365323	hsa-miR-449b	CLIP-seq
MIRT2659074	hsa-miR-449c	CLIP-seq
MIRT1481675	hsa-miR-450b-3p	CLIP-seq
MIRT2365324	hsa-miR-4514	CLIP-seq
MIRT2659075	hsa-miR-4519	CLIP-seq
MIRT1481676	hsa-miR-4525	CLIP-seq
MIRT2659076	hsa-miR-4530	CLIP-seq
MIRT2659077	hsa-miR-4534	CLIP-seq
MIRT2365326	hsa-miR-455-3p	CLIP-seq
MIRT2659078	hsa-miR-4640-3p	CLIP-seq
MIRT1481679	hsa-miR-4656	CLIP-seq
MIRT1481681	hsa-miR-4665-5p	CLIP-seq
MIRT2659079	hsa-miR-4684-5p	CLIP-seq
MIRT1481683	hsa-miR-4685-5p	CLIP-seq
MIRT2365327	hsa-miR-4692	CLIP-seq
MIRT2659080	hsa-miR-4694-3p	CLIP-seq
MIRT1481685	hsa-miR-4697-5p	CLIP-seq
MIRT1481689	hsa-miR-4723-5p	CLIP-seq
MIRT2144904	hsa-miR-4728-5p	CLIP-seq
MIRT2365331	hsa-miR-4742-5p	CLIP-seq
MIRT1481693	hsa-miR-4745-5p	CLIP-seq
MIRT2144909	hsa-miR-4763-3p	CLIP-seq
MIRT2659082	hsa-miR-4764-3p	CLIP-seq
MIRT2659083	hsa-miR-4765	CLIP-seq
MIRT1481695	hsa-miR-4766-5p	CLIP-seq
MIRT2659084	hsa-miR-4771	CLIP-seq
MIRT2365332	hsa-miR-4772-5p	CLIP-seq
MIRT2144910	hsa-miR-4779	CLIP-seq
MIRT2659085	hsa-miR-4797-3p	CLIP-seq
MIRT2365334	hsa-miR-486-3p	CLIP-seq
MIRT1481701	hsa-miR-513b	CLIP-seq
MIRT2659086	hsa-miR-541	CLIP-seq
MIRT2659088	hsa-miR-548s	CLIP-seq
MIRT2365336	hsa-miR-603	CLIP-seq
MIRT2365338	hsa-miR-612	CLIP-seq
MIRT1481709	hsa-miR-625	CLIP-seq
MIRT2659089	hsa-miR-645	CLIP-seq
MIRT2659090	hsa-miR-654-5p	CLIP-seq
MIRT2659091	hsa-miR-663b	CLIP-seq
MIRT2659092	hsa-miR-708	CLIP-seq
MIRT2659093	hsa-miR-761	CLIP-seq
MIRT1481711	hsa-miR-765	CLIP-seq
MIRT1481712	hsa-miR-769-3p	CLIP-seq
MIRT1481713	hsa-miR-939	CLIP-seq
MIRT2144913	hsa-miR-940	CLIP-seq
MIRT2659094	hsa-miR-942	CLIP-seq

Transcription factor	Regulation	Reference
SP1	Activation	8774732

74 Show/Hide all (74)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000149	Function	SNARE binding	ISS
GO:0005484	Function	SNAP receptor activity	IBA
GO:0005515	Function	Protein binding	IPI	9920726, 10481273, 17196367, 17313651, 19478182, 19543288, 20798282, 22118466, 22172278, 25416956, 26635000, 32296183, 32814053, 33961781, 37776851, 38225382
GO:0005516	Function	Calmodulin binding	ISS
GO:0005543	Function	Phospholipid binding	ISS
GO:0005802	Component	Trans-Golgi network	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	1976629
GO:0006887	Process	Exocytosis	TAS	10099709
GO:0006906	Process	Vesicle fusion	IBA
GO:0006906	Process	Vesicle fusion	IMP	30929742
GO:0008021	Component	Synaptic vesicle	ISS
GO:0008021	Component	Synaptic vesicle	TAS	10099709
GO:0008076	Component	Voltage-gated potassium channel complex	ISS
GO:0009749	Process	Response to glucose	ISS
GO:0015031	Process	Protein transport	IMP	16677249
GO:0016020	Component	Membrane	IDA	16677249, 22375059
GO:0016020	Component	Membrane	IEA
GO:0016079	Process	Synaptic vesicle exocytosis	ISS
GO:0016079	Process	Synaptic vesicle exocytosis	TAS	15217342
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0016192	Process	Vesicle-mediated transport	ISS
GO:0017075	Function	Syntaxin-1 binding	IBA
GO:0017075	Function	Syntaxin-1 binding	ISS
GO:0017156	Process	Calcium-ion regulated exocytosis	ISS
GO:0017157	Process	Regulation of exocytosis	ISS
GO:0019905	Function	Syntaxin binding	IPI	12855681
GO:0019905	Function	Syntaxin binding	ISS
GO:0030133	Component	Transport vesicle	IEA
GO:0030136	Component	Clathrin-coated vesicle	IDA	19478182
GO:0030141	Component	Secretory granule	ISS
GO:0030667	Component	Secretory granule membrane	IDA	16677249
GO:0030667	Component	Secretory granule membrane	TAS
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0030672	Component	Synaptic vesicle membrane	ISS
GO:0030672	Component	Synaptic vesicle membrane	TAS
GO:0031201	Component	SNARE complex	IBA
GO:0031201	Component	SNARE complex	IDA	12130530, 12730201, 19546860
GO:0031201	Component	SNARE complex	TAS	10099709
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031410	Component	Cytoplasmic vesicle	ISS
GO:0031982	Component	Vesicle	IDA	17313651
GO:0032869	Process	Cellular response to insulin stimulus	ISS
GO:0035493	Process	SNARE complex assembly	IBA
GO:0042589	Component	Zymogen granule membrane	ISS
GO:0043001	Process	Golgi to plasma membrane protein transport	ISS
GO:0043005	Component	Neuron projection	ISS
GO:0043308	Process	Eosinophil degranulation	IMP	16677249
GO:0043312	Process	Neutrophil degranulation	IMP	16677249
GO:0043320	Process	Natural killer cell degranulation	IMP	18042464
GO:0044306	Component	Neuron projection terminus	ISS
GO:0045202	Component	Synapse	IEA
GO:0045202	Component	Synapse	ISS
GO:0048306	Function	Calcium-dependent protein binding	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0048488	Process	Synaptic vesicle endocytosis	ISS
GO:0060203	Component	Clathrin-sculpted glutamate transport vesicle membrane	TAS
GO:0060291	Process	Long-term synaptic potentiation	ISS
GO:0060627	Process	Regulation of vesicle-mediated transport	ISS
GO:0061025	Process	Membrane fusion	ISS
GO:0061202	Component	Clathrin-sculpted gamma-aminobutyric acid transport vesicle membrane	TAS
GO:0065003	Process	Protein-containing complex assembly	ISS
GO:0070032	Component	Synaptobrevin 2-SNAP-25-syntaxin-1a-complexin I complex	ISS
GO:0070033	Component	Synaptobrevin 2-SNAP-25-syntaxin-1a-complexin II complex	ISS
GO:0070044	Component	Synaptobrevin 2-SNAP-25-syntaxin-1a complex	ISS
GO:0070083	Component	Clathrin-sculpted monoamine transport vesicle membrane	TAS
GO:0070254	Process	Mucus secretion	IMP	22144578
GO:0090316	Process	Positive regulation of intracellular protein transport	ISS
GO:1902259	Process	Regulation of delayed rectifier potassium channel activity	ISS
GO:1903593	Process	Regulation of histamine secretion by mast cell	IMP	18253931

MIM	HGNC	e!Ensembl
185881	12643	ENSG00000220205

P63027

Protein name

Vesicle-associated membrane protein 2 (VAMP-2) (Synaptobrevin-2)

Protein function

Involved in the targeting and/or fusion of transport vesicles to their target membrane (By similarity). Major SNARE protein of synaptic vesicles which mediates fusion of synaptic vesicles to release neurotransmitters. Essential for fast vesicula

PDB

3FIE , 3FII , 3RK2 , 3RK3 , 3RL0 , 7UDC , 9CKX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00957	Synaptobrevin	28 → 116	Synaptobrevin	Family

Tissue specificity

TISSUE SPECIFICITY: Nervous system and skeletal muscle. {ECO:0000269|PubMed:8760387}.

Sequence

MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKL
SELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST

Sequence length

116

Interactions

View interactions

KEGG Pathway	Reactome Pathway
SNARE interactions in vesicular transport	Serotonin Neurotransmitter Release Cycle
Synaptic vesicle cycle	Norepinephrine Neurotransmitter Release Cycle
Insulin secretion	trans-Golgi Network Vesicle Budding
Vasopressin-regulated water reabsorption	Glutamate Neurotransmitter Release Cycle
Salivary secretion	Dopamine Neurotransmitter Release Cycle
	Acetylcholine Neurotransmitter Release Cycle
	Lysosome Vesicle Biogenesis
	Golgi Associated Vesicle Biogenesis
	Other interleukin signaling
	Toxicity of botulinum toxin type D (BoNT/D)
	Toxicity of botulinum toxin type B (BoNT/B)
	Toxicity of botulinum toxin type F (BoNT/F)
	Toxicity of tetanus toxin (TeNT)
	Toxicity of botulinum toxin type G (BoNT/G)
	Cargo recognition for clathrin-mediated endocytosis
	Clathrin-mediated endocytosis
	GABA synthesis, release, reuptake and degradation
	Insertion of tail-anchored proteins into the endoplasmic reticulum membrane

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Neurodevelopmental disorder with hypotonia and autistic features with or without hyperkinetic movements	Likely pathogenic; Pathogenic	rs2507691218, rs1598265441, rs1598265387, rs1598265382, rs1598265384, rs1598265438	RCV003994625 RCV000999497 RCV000999494 RCV000999495 RCV000999496 RCV000999498 View all (1 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Severe neurodevelopmental delay	Pathogenic	rs1598265441	RCV000824682	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MAJOR DEPRESSIVE DISORDER	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental disorder	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VAMP2-related disorder	Likely benign; Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (54)
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26134228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32812023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	25445064, 28130000, 28461697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic behavior	Autism	GENOMICS_ENGLAND_DG	30929742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	30929742, 32906212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	18628682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30672978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19861515, 35068871, 37674210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30672978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central visual impairment	Central Visual Impairment	GENOMICS_ENGLAND_DG	30929742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	32906212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	30929742, 32906212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	16443778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	16443778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28812028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	27458546, 30929742, 32906212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	27458546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Cryptogenic	Epilepsy	BEFREE	27458546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	GENOMICS_ENGLAND_DG	30929742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Hyperkinesia	Pubtator	30929742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30649208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	19557857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG	30929742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	30929742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	18628682		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	18628682		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	18628682		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	18628682		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	18628682		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	18628682		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	18628682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	PSYGENET_DG	24886127		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	24886127		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30672978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	19557857		★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, AUTOSOMAL DOMINANT 40	Mental retardation	GENOMICS_ENGLAND_DG	30929742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	37380951	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	GENOMICS_ENGLAND_DG	30929742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30582321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	30582321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	31192914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	35586671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26134228, 30721745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	30929742		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Night blindness congenital stationary	Night blindness, congenital stationary	Pubtator	36380732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	39953608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30721745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	35563596, 36380732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18512733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32064753	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stereotyped Behavior	Stereotyped Behavior	GENOMICS_ENGLAND_DG	30929742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	24886127		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vision Disorders	Visual disorder	Pubtator	30929742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Visual Cortex Disorder	Visual cortex disease	GENOMICS_ENGLAND_DG	30929742		★★★★★ ★☆☆☆☆ Found in Text Mining only

VAMP2 (vesicle associated membrane protein 2)

Bookmark This Gene