USE1 (unconventional SNARE in the ER 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 55850
Gene name Unconventional SNARE in the ER 1
Gene symbol USE1
Synonyms (NCBI Gene)
D12MDS032P31SLT1
Chromosome 19
Chromosome location 19p13.11
miRNA miRNA information provided by mirtarbase database.
2
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT028623 hsa-miR-30a-5p Proteomics 18668040
MIRT051637 hsa-let-7e-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23 Show/Hide all (23)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005484 Function SNAP receptor activity IBA
GO:0005515 Function Protein binding IPI 15029241, 15272311, 19369418, 25416956, 28514442, 29929043, 32296183, 33961781, 35271311
GO:0005764 Component Lysosome ISS 16354670
GO:0005783 Component Endoplasmic reticulum IBA
GO:0005783 Component Endoplasmic reticulum IDA 15029241
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
610675 30882 ENSG00000053501
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NZ43
Protein name Vesicle transport protein USE1 (Putative MAPK-activating protein PM26) (USE1-like protein) (p31)
Protein function SNARE that may be involved in targeting and fusion of Golgi-derived retrograde transport vesicles with the ER.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09753 Use1 5 → 255 Membrane fusion protein Use1 Family
Sequence 
MAASRLELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASEVINE
YSWKVDFLKGMLQAEKLTSSSEKALANQFLAPGRVPTTARERVPATKTVHLQSRARYTSE
MRSELLGTDSAEPEMDVRKRTGVAGSQPVSEKQLAAELDLVLQRHQNLQEKLAEEMLGLA
RSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKSVNWLLWAMLII
VCFIFISMILFIRIMPKLK
Sequence length 259
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
SNARE interactions in vesicular transport COPI-dependent Golgi-to-ER retrograde traffic
Sort by:
BNIP1 2 shared pathwaysSNARE interactions in vesicular transport, COPI-dependent Golgi-to-ER retrograde traffic Related via 2 shared pathways including SNARE interactions in vesicular transport, COPI-dependent Golgi-to-ER retrograde traffic. STX18 2 shared pathwaysSNARE interactions in vesicular transport, COPI-dependent Golgi-to-ER retrograde traffic Related via 2 shared pathways including SNARE interactions in vesicular transport, COPI-dependent Golgi-to-ER retrograde traffic. SEC22B 2 shared pathwaysSNARE interactions in vesicular transport, COPI-dependent Golgi-to-ER retrograde traffic Related via 2 shared pathways including SNARE interactions in vesicular transport, COPI-dependent Golgi-to-ER retrograde traffic.
Atrial fibrillation Linked via 1 of 3 related genesBNIP1 Cardiac embolism Linked via 1 of 3 related genesBNIP1 Cardioembolic stroke Linked via 1 of 3 related genesBNIP1 Endometriosis Linked via 1 of 3 related genesBNIP1 Migraine Linked via 1 of 3 related genesBNIP1