UBE3D (ubiquitin protein ligase E3D)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 90025
• Gene name: Ubiquitin protein ligase E3D
• Gene symbol: UBE3D
• Synonyms (NCBI Gene): C6orf157, H10BH, UBE2CBP, YJR141W
• Chromosome: 6
• Chromosome location: 6q14.1

Gene ontology (GO) Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IBA
GO:0000151	Component	Ubiquitin ligase complex	IDA	15749827
GO:0000209	Process	Protein polyubiquitination	IBA
GO:0000209	Process	Protein polyubiquitination	IDA	15749827
GO:0005515	Function	Protein binding	IPI	27173435, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	39032490
GO:0006513	Process	Protein monoubiquitination	IBA
GO:0006513	Process	Protein monoubiquitination	IDA	15749827
GO:0008428	Function	Ribonuclease inhibitor activity	IDA	39032490
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030332	Function	Cyclin binding	IBA
GO:0030332	Function	Cyclin binding	IPI	15749827
GO:0031624	Function	Ubiquitin conjugating enzyme binding	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0044390	Function	Ubiquitin-like protein conjugating enzyme binding	IPI	15749827
GO:0051865	Process	Protein autoubiquitination	IBA
GO:0051865	Process	Protein autoubiquitination	IDA	15749827
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	15749827
GO:0061630	Function	Ubiquitin protein ligase activity	IEA

Other IDs

• MIM: 612495
• HGNC: 21381
• e!Ensembl: ENSG00000118420

Protein

• UniProt ID: Q7Z6J8
• Protein name: E3 ubiquitin-protein ligase E3D (EC 2.3.2.26) (HECT-type E3 ubiquitin transferase E3D) (UbcH10-binding protein with a HECT-like domain) (Ubiquitin-conjugating enzyme E2C-binding protein)
• Protein function: E3 ubiquitin-protein ligase which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfers it to substrates, generally promoting their degradation by the proteasome (PubMed:15749827). Independently of its E3 ubiquitin-prot
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF09814	HECT_2	13 → 384	HECT-like Ubiquitin-conjugating enzyme (E2)-binding	Domain

• Sequence:

  MAASAAETRVFLEVRGQLQSALLILGEPKEGGMPMNISIMPSSLQMKTPEGCTEIQLPAE
  VRLVPSSCRGLQFVVGDGLHLRLQTQAKLGTKLISMFNQSSQTQECCTFYCQSCGEVIIK
  DRKLLRVLPLPSENWGALVGEWCCHPDPFANKSLHPQENDCFIGDSFFLVNLRTSLWQQR
  PELSPVEMCCVSSDNHCKLEPKANTKVICKRCKVMLGETVSSETTKFYMTEIIIQSSERS
  FPIIPRSWFVQSVIAQCLVQLSSARSTFRFTIQGQDDKVYILLWLLNSDSLVIESLRNSK
  YIKKFPLLENTFKADSSSAWSAVKVLYQPCIKSRNEKLVSLWESDISVHPLTLPSATCLE
  LLLILSKSNANLPSSLRRVNSFQVAFLKM

• Sequence length: 389

Pathways

Reactome Pathway:

Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (12)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
BIPOLAR DISORDER	—	GWAS catalog	34099189	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	26891255	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DRY EYE SYNDROME	—	GWAS catalog	38767906	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	GWAS catalog	37673066	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	26891255	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	34099189	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	37040585	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	34099189, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	38374256, 39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Age related macular degeneration	Age-related macular degeneration	BEFREE	25872646		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	26962152		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	26962152		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	26891255		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

TPBG 2 shared diseasesDry eye syndrome, Pelvic organ prolapse 2 shared evidence sourcesGWAS catalog (Dry eye syndrome), GWAS catalog (Pelvic organ prolapse) Related via 2 shared diseases including Dry eye syndrome, Pelvic organ prolapse — evidence mostly GWAS catalog. SLIT3 2 shared diseasesDry eye syndrome, Pelvic organ prolapse 2 shared evidence sourcesGWAS catalog (Dry eye syndrome), GWAS catalog (Pelvic organ prolapse) Related via 2 shared diseases including Dry eye syndrome, Pelvic organ prolapse — evidence mostly GWAS catalog. WWOX 2 shared diseasesEsophageal squamous cell carcinoma, Pelvic organ prolapse 1 shared evidence sourceGWAS catalog (Pelvic organ prolapse) Related via 2 shared diseases including Esophageal squamous cell carcinoma, Pelvic organ prolapse — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
TPBG	2	["Dry eye syndrome","Pelvic organ prolapse"]	0	[]	2	["GWAS catalog (Dry eye syndrome)","GWAS catalog (Pelvic organ prolapse)"]
SLIT3	2	["Dry eye syndrome","Pelvic organ prolapse"]	0	[]	2	["GWAS catalog (Dry eye syndrome)","GWAS catalog (Pelvic organ prolapse)"]
WWOX	2	["Esophageal squamous cell carcinoma","Pelvic organ prolapse"]	0	[]	1	["GWAS catalog (Pelvic organ prolapse)"]

Diseases Linked via Similar Genes

Multiple sclerosis Linked via 2 of 3 related genesSLIT3, WWOX Stroke Linked via 2 of 3 related genesSLIT3, WWOX Prostate cancer Linked via 1 of 3 related genesTPBG Prostatic neoplasms Linked via 1 of 3 related genesTPBG Eczema Linked via 1 of 3 related genesSLIT3

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Multiple sclerosis	2	["SLIT3","WWOX"]
Stroke	2	["SLIT3","WWOX"]
Prostate cancer	1	["TPBG"]
Prostatic neoplasms	1	["TPBG"]
Eczema	1	["SLIT3"]