U2AF1L4 (U2 small nuclear RNA auxiliary factor 1 like 4)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 199746
Gene name U2 small nuclear RNA auxiliary factor 1 like 4
Gene symbol U2AF1L4
Synonyms (NCBI Gene)
U2AF1-RS3U2AF1L3U2AF1L3V1U2AF1RS3U2af26
Chromosome 19
Chromosome location 19q13.12
miRNA miRNA information provided by mirtarbase database.
8 Show/Hide all (8)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT439369 hsa-miR-543 HITS-CLIP 24374217
MIRT439369 hsa-miR-543 HITS-CLIP 24374217
MIRT2140130 hsa-miR-208a CLIP-seq
MIRT2140131 hsa-miR-208b CLIP-seq
MIRT2140132 hsa-miR-3617 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17 Show/Hide all (17)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000398 Process MRNA splicing, via spliceosome IBA
GO:0000398 Process MRNA splicing, via spliceosome IEA
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IEA
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
601080 23020 ENSG00000161265
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WU68
Protein name Splicing factor U2AF 26 kDa subunit (U2 auxiliary factor 26) (U2 small nuclear RNA auxiliary factor 1-like protein 4) (U2AF1-like 4) (U2(RNU2) small nuclear RNA auxiliary factor 1-like protein 3) (U2 small nuclear RNA auxiliary factor 1-like protein 3) (U
Protein function RNA-binding protein that function as a pre-mRNA splicing factor. Plays a critical role in both constitutive and enhancer-dependent splicing by mediating protein-protein interactions and protein-RNA interactions required for accurate 3'-splice si
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 82 → 141 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00642 zf-CCCH 13 → 39 Zinc finger C-x8-C-x5-C-x3-H type (and similar) Family
PF00642 zf-CCCH 149 → 175 Zinc finger C-x8-C-x5-C-x3-H type (and similar) Family
Tissue specificity TISSUE SPECIFICITY: Isoform 2 is widely expressed. Isoform 3 is highly expressed in heart, brain and lung, lower expressed in thymus and much lower expressed in peripheral blood leukocytes. {ECO:0000269|PubMed:17312947}.
Sequence 
MAEYLASIFGTEKDKVNCSFYFKIGVCRHGDRCSRLHNKPTFSQTIVLLNLYRNPQNTAQ
TADGSHCHVSDVEVQEHYDSFFEEVFTELQEKYGEIEEMNVCDNLGDHLVGNVYVKFRRE
EDGERAVAELSNRWFNGQAVHGELSPVTDFRESCCRQYEMGECTRGGFCNFMHLRPISQN
LQRQLYGRGPRRRSPPRFHTGHHPRERNHRCSPDHWHGRF
Sequence length 220
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Spliceosome Transport of Mature mRNA derived from an Intron-Containing Transcript
Shigellosis mRNA Splicing - Major Pathway
  mRNA 3'-end processing
  RNA Polymerase II Transcription Termination
Sort by:
U2AF1 6 shared pathwaysSpliceosome, Shigellosis, mRNA Splicing - Major Pathway, Transport of Mature mRNA derived from an Intron-Containing Transcript, mRNA 3'-end processing, RNA Polymerase II Transcription Termination Related via 6 shared pathways including Spliceosome, Shigellosis. SLU7 5 shared pathwaysSpliceosome, mRNA Splicing - Major Pathway, Transport of Mature mRNA derived from an Intron-Containing Transcript, mRNA 3'-end processing, RNA Polymerase II Transcription Termination Related via 5 shared pathways including Spliceosome, mRNA Splicing - Major Pathway. U2AF2 5 shared pathwaysSpliceosome, mRNA Splicing - Major Pathway, Transport of Mature mRNA derived from an Intron-Containing Transcript, mRNA 3'-end processing, RNA Polymerase II Transcription Termination Related via 5 shared pathways including Spliceosome, mRNA Splicing - Major Pathway. CDC40 5 shared pathwaysSpliceosome, mRNA Splicing - Major Pathway, Transport of Mature mRNA derived from an Intron-Containing Transcript, mRNA 3'-end processing, RNA Polymerase II Transcription Termination Related via 5 shared pathways including Spliceosome, mRNA Splicing - Major Pathway. DHX38 5 shared pathwaysSpliceosome, mRNA Splicing - Major Pathway, Transport of Mature mRNA derived from an Intron-Containing Transcript, mRNA 3'-end processing, RNA Polymerase II Transcription Termination Related via 5 shared pathways including Spliceosome, mRNA Splicing - Major Pathway.
Iron metabolism disorder Linked via 1 of 5 related genesU2AF1 Metabolic syndrome Linked via 1 of 5 related genesU2AF1 Myelodysplastic syndrome Linked via 1 of 5 related genesU2AF1 Osteoporosis Linked via 1 of 5 related genesU2AF1 Prostatic neoplasms Linked via 1 of 5 related genesU2AF1