TUBB8B (tubulin beta 8B)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 260334
• Gene name: Tubulin beta 8B
• Gene symbol: TUBB8B
• Synonyms (NCBI Gene): TUBB8P12
• Chromosome: 18
• Chromosome location: 18p11.32

Gene ontology (GO) Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000226	Process	Microtubule cytoskeleton organization	IBA
GO:0000278	Process	Mitotic cell cycle	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0005200	Function	Structural constituent of cytoskeleton	IBA
GO:0005200	Function	Structural constituent of cytoskeleton	IEA
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IEA
GO:0007017	Process	Microtubule-based process	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0045171	Component	Intercellular bridge	IDA
GO:0045171	Component	Intercellular bridge	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0072686	Component	Mitotic spindle	IDA
GO:0072686	Component	Mitotic spindle	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: A6NNZ2
• Protein name: Tubulin beta 8B
• Protein function: Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers. Microtubules grow by the addition of GTP-tubulin dimers to the microtubule en
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00091	Tubulin	3 → 212	Tubulin/FtsZ family, GTPase domain	Domain
  PF03953	Tubulin_C	261 → 383	Tubulin C-terminal domain	Domain

• Sequence:

  MREIVLTQTGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQLERINVHHHEASGGRYV
  PRAVLVDLEPGTMDSVHSGPFGQVFRPDNFISGQCGAGNNWAKGRYTEGAELTESVMDVV
  RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIINTFSILPSPKVSDTVV
  EPYNATLSVHQLIENADETFCIDNEALYDICSRTLKLPTPTYGDLNHLVSATMSGVTTCL
  RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVAELTQQMFDAKNMM
  AACDPRHGCYLTVAAIFRGRMPMREVDEQMFNIQDKNSSYFADWFPDNVKTAVCDIPPRG
  LKMSATFIGNNAAIQELFTCVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
  EYQQYQDATAEEEEDEEYAEEEVA

• Sequence length: 444

Pathways

KEGG Pathway

Phagosome

Gap junction

Motor proteins

Alzheimer disease

Parkinson disease

Amyotrophic lateral sclerosis

Huntington disease

Prion disease

Pathways of neurodegeneration - multiple diseases

Pathogenic Escherichia coli infection

Salmonella infection

Related Genes

Sort by: Blended Diseases Pathways Evidence source

TUBB 7 shared pathwaysPhagosome, Gap junction, Motor proteins, Parkinson disease, Prion disease, Pathogenic Escherichia coli infection, Salmonella infection Related via 7 shared pathways including Phagosome, Gap junction. KIF5C 4 shared pathwaysMotor proteins, Parkinson disease, Prion disease, Salmonella infection Related via 4 shared pathways including Motor proteins, Parkinson disease. KLC3 4 shared pathwaysMotor proteins, Parkinson disease, Prion disease, Salmonella infection Related via 4 shared pathways including Motor proteins, Parkinson disease. KLC1 4 shared pathwaysMotor proteins, Parkinson disease, Prion disease, Salmonella infection Related via 4 shared pathways including Motor proteins, Parkinson disease. KLC2 4 shared pathwaysMotor proteins, Parkinson disease, Prion disease, Salmonella infection Related via 4 shared pathways including Motor proteins, Parkinson disease.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
TUBB	0	[]	7	["Phagosome","Gap junction","Motor proteins","Parkinson disease","Prion disease","Pathogenic Escherichia coli infection","Salmonella infection"]	0	[]
KIF5C	0	[]	4	["Motor proteins","Parkinson disease","Prion disease","Salmonella infection"]	0	[]
KLC3	0	[]	4	["Motor proteins","Parkinson disease","Prion disease","Salmonella infection"]	0	[]
KLC1	0	[]	4	["Motor proteins","Parkinson disease","Prion disease","Salmonella infection"]	0	[]
KLC2	0	[]	4	["Motor proteins","Parkinson disease","Prion disease","Salmonella infection"]	0	[]

Diseases Linked via Similar Genes

Autism Linked via 3 of 5 related genesTUBB, KIF5C, KLC1 Schizophrenia Linked via 3 of 5 related genesTUBB, KIF5C, KLC1 Complex cortical dysplasia with other brain malformations Linked via 2 of 5 related genesTUBB, KIF5C Cortical dysplasia with other brain malformations Linked via 2 of 5 related genesTUBB, KIF5C Attention deficit hyperactivity disorder Linked via 2 of 5 related genesKIF5C, KLC1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Autism	3	["TUBB","KIF5C","KLC1"]
Schizophrenia	3	["TUBB","KIF5C","KLC1"]
Complex cortical dysplasia with other brain malformations	2	["TUBB","KIF5C"]
Cortical dysplasia with other brain malformations	2	["TUBB","KIF5C"]
Attention deficit hyperactivity disorder	2	["KIF5C","KLC1"]