TUBA3C (tubulin alpha 3c)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 7278
• Gene name: Tubulin alpha 3c
• Gene symbol: TUBA3C
• Synonyms (NCBI Gene): TUBA2, bA408E5.3
• Chromosome: 13
• Chromosome location: 13q12.11
• Summary: Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of si

Gene ontology (GO) Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000226	Process	Microtubule cytoskeleton organization	IBA
GO:0000278	Process	Mitotic cell cycle	IBA
GO:0005200	Function	Structural constituent of cytoskeleton	IBA
GO:0005200	Function	Structural constituent of cytoskeleton	IEA
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IEA
GO:0005929	Component	Cilium	IDA
GO:0007017	Process	Microtubule-based process	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0015630	Component	Microtubule cytoskeleton	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 602528
• HGNC: 12408
• e!Ensembl: ENSG00000198033

Protein

• UniProt ID: P0DPH7
• Protein name: Tubulin alpha-3C chain (EC 3.6.5.-) (Alpha-tubulin 2) (Alpha-tubulin 3C) (Tubulin alpha-2 chain) [Cleaved into: Detyrosinated tubulin alpha-3C chain]
• Protein function: Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers. Microtubules grow by the addition of GTP-tubulin dimers to the microtubule en
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00091	Tubulin	3 → 214	Tubulin/FtsZ family, GTPase domain	Domain
  PF03953	Tubulin_C	263 → 393	Tubulin C-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in testis. {ECO:0000269|Ref.5}.
• Sequence:

  MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
  HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLD
  RIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTA
  VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
  SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
  QMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
  TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
  AREDLAALEKDYEEVGVDSVEAEAEEGEEY

• Sequence length: 450

Pathways

KEGG Pathway	Reactome Pathway
Phagosome	Microtubule-dependent trafficking of connexons from Golgi to the plasma membrane
Apoptosis	MHC class II antigen presentation
Tight junction	Separation of Sister Chromatids
Gap junction	Resolution of Sister Chromatid Cohesion
Motor proteins	HSP90 chaperone cycle for steroid hormone receptors (SHR)
Alzheimer disease	Recruitment of NuMA to mitotic centrosomes
Parkinson disease	Recycling pathway of L1
Amyotrophic lateral sclerosis	Hedgehog 'off' state
Huntington disease	Cilium Assembly
Prion disease	Intraflagellar transport
Pathways of neurodegeneration - multiple diseases	RHO GTPases activate IQGAPs
Pathogenic Escherichia coli infection	RHO GTPases Activate Formins
Salmonella infection	COPI-mediated anterograde transport
	COPI-dependent Golgi-to-ER retrograde traffic
	COPI-independent Golgi-to-ER retrograde traffic
	Mitotic Prometaphase
	The role of GTSE1 in G2/M progression after G2 checkpoint
	Carboxyterminal post-translational modifications of tubulin
	HCMV Early Events
	Aggrephagy
	EML4 and NUDC in mitotic spindle formation
	Sealing of the nuclear envelope (NE) by ESCRT-III
	Kinesins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	39998322	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ANEURYSM	—	GWAS catalog	27171184	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (13)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	27171184		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	30423812	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	27171184	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	27171184	Associate	★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Ventricular	Congenital heart septal defect	Pubtator	30423812	Associate	★☆☆☆☆ Found in Text Mining only
Hidrotic Ectodermal Dysplasia	Hidrotic Ectodermal Dysplasia	BEFREE	9465305		★☆☆☆☆ Found in Text Mining only
Kabuki make-up syndrome	Kabuki Syndrome	BEFREE	9465305		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	27171184		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	27171184	Associate	★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	16126374		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	9627113		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	25520250	Associate	★☆☆☆☆ Found in Text Mining only
Teratozoospermia	Teratozoospermia	BEFREE	22125161		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

TUBA1B 32 shared pathwaysPhagosome, Apoptosis, Tight junction, Gap junction, Motor proteins, Parkinson disease, Prion disease, Pathogenic Escherichia coli infection, Salmonella infection, Cilium Assembly, Aggrephagy, COPI-mediated anterograde transport +20 more Related via 32 shared pathways including Phagosome, Apoptosis. TUBA3D 32 shared pathwaysPhagosome, Apoptosis, Tight junction, Gap junction, Motor proteins, Parkinson disease, Prion disease, Pathogenic Escherichia coli infection, Salmonella infection, Cilium Assembly, Aggrephagy, COPI-mediated anterograde transport +20 more Related via 32 shared pathways including Phagosome, Apoptosis. TUBA1C 32 shared pathwaysPhagosome, Apoptosis, Tight junction, Gap junction, Motor proteins, Parkinson disease, Prion disease, Pathogenic Escherichia coli infection, Salmonella infection, Cilium Assembly, Aggrephagy, COPI-mediated anterograde transport +20 more Related via 32 shared pathways including Phagosome, Apoptosis. TUBB3 30 shared pathwaysPhagosome, Gap junction, Motor proteins, Parkinson disease, Prion disease, Pathogenic Escherichia coli infection, Salmonella infection, Cilium Assembly, Aggrephagy, COPI-mediated anterograde transport, COPI-dependent Golgi-to-ER retrograde traffic, Separation of Sister Chromatids +18 more Related via 30 shared pathways including Phagosome, Gap junction. TUBA3E 30 shared pathwaysPhagosome, Apoptosis, Tight junction, Gap junction, Motor proteins, Parkinson disease, Prion disease, Pathogenic Escherichia coli infection, Salmonella infection, Cilium Assembly, Aggrephagy, COPI-mediated anterograde transport +18 more Related via 30 shared pathways including Phagosome, Apoptosis.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
TUBA1B	0	[]	32	["Phagosome","Apoptosis","Tight junction","Gap junction","Motor proteins","Parkinson disease","Prion disease","Pathogenic Escherichia coli infection","Salmonella infection","Cilium Assembly","Aggrephagy","COPI-mediated anterograde transport"]	0	[]
TUBA3D	0	[]	32	["Phagosome","Apoptosis","Tight junction","Gap junction","Motor proteins","Parkinson disease","Prion disease","Pathogenic Escherichia coli infection","Salmonella infection","Cilium Assembly","Aggrephagy","COPI-mediated anterograde transport"]	0	[]
TUBA1C	0	[]	32	["Phagosome","Apoptosis","Tight junction","Gap junction","Motor proteins","Parkinson disease","Prion disease","Pathogenic Escherichia coli infection","Salmonella infection","Cilium Assembly","Aggrephagy","COPI-mediated anterograde transport"]	0	[]
TUBB3	0	[]	30	["Phagosome","Gap junction","Motor proteins","Parkinson disease","Prion disease","Pathogenic Escherichia coli infection","Salmonella infection","Cilium Assembly","Aggrephagy","COPI-mediated anterograde transport","COPI-dependent Golgi-to-ER retrograde traffic","Separation of Sister Chromatids"]	0	[]
TUBA3E	0	[]	30	["Phagosome","Apoptosis","Tight junction","Gap junction","Motor proteins","Parkinson disease","Prion disease","Pathogenic Escherichia coli infection","Salmonella infection","Cilium Assembly","Aggrephagy","COPI-mediated anterograde transport"]	0	[]

Diseases Linked via Similar Genes

Congenital fibrosis of extraocular muscles Linked via 2 of 5 related genesTUBA1B, TUBB3 Osteoporosis Linked via 2 of 5 related genesTUBA1B, TUBA1C Lissencephaly Linked via 2 of 5 related genesTUBB3, TUBA3E Neurodevelopmental disorder Linked via 2 of 5 related genesTUBB3, TUBA3E Neuromuscular disease Linked via 1 of 5 related genesTUBA1B

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Congenital fibrosis of extraocular muscles	2	["TUBA1B","TUBB3"]
Osteoporosis	2	["TUBA1B","TUBA1C"]
Lissencephaly	2	["TUBB3","TUBA3E"]
Neurodevelopmental disorder	2	["TUBB3","TUBA3E"]
Neuromuscular disease	1	["TUBA1B"]