TTF1 (transcription termination factor 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 7270
• Gene name: Transcription termination factor 1
• Gene symbol: TTF1
• Synonyms (NCBI Gene): TTF-1, TTF-I
• Chromosome: 9
• Chromosome location: 9q34.13
• Summary: This gene encodes a transcription termination factor that is localized to the nucleolus and plays a critical role in ribosomal gene transcription. The encoded protein mediates the termination of RNA polymerase I transcription by binding to Sal box termina

miRNA Show/Hide all (61)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020919	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT439140	hsa-let-7c-5p	3'LIFE	25074381
MIRT439140	hsa-let-7c-5p	3'LIFE	25074381
MIRT1462029	hsa-miR-1343	CLIP-seq
MIRT1462030	hsa-miR-197	CLIP-seq
MIRT1462031	hsa-miR-1972	CLIP-seq
MIRT1462032	hsa-miR-24	CLIP-seq
MIRT1462033	hsa-miR-3125	CLIP-seq
MIRT1462034	hsa-miR-3916	CLIP-seq
MIRT1462035	hsa-miR-412	CLIP-seq
MIRT1462036	hsa-miR-4284	CLIP-seq
MIRT1462037	hsa-miR-4650-5p	CLIP-seq
MIRT1462038	hsa-miR-4680-5p	CLIP-seq
MIRT1462039	hsa-miR-4716-5p	CLIP-seq
MIRT1462040	hsa-miR-4772-3p	CLIP-seq
MIRT1462041	hsa-miR-4781-3p	CLIP-seq
MIRT1462042	hsa-miR-498	CLIP-seq
MIRT1462043	hsa-miR-520a-5p	CLIP-seq
MIRT1462044	hsa-miR-525-5p	CLIP-seq
MIRT1462029	hsa-miR-1343	CLIP-seq
MIRT1462045	hsa-miR-1976	CLIP-seq
MIRT1462046	hsa-miR-4279	CLIP-seq
MIRT1462047	hsa-miR-4722-3p	CLIP-seq
MIRT1462042	hsa-miR-498	CLIP-seq
MIRT1462029	hsa-miR-1343	CLIP-seq
MIRT1462045	hsa-miR-1976	CLIP-seq
MIRT1462046	hsa-miR-4279	CLIP-seq
MIRT1462047	hsa-miR-4722-3p	CLIP-seq
MIRT1462042	hsa-miR-498	CLIP-seq
MIRT1462029	hsa-miR-1343	CLIP-seq
MIRT1462032	hsa-miR-24	CLIP-seq
MIRT1462036	hsa-miR-4284	CLIP-seq
MIRT1462040	hsa-miR-4772-3p	CLIP-seq
MIRT1462042	hsa-miR-498	CLIP-seq
MIRT1462029	hsa-miR-1343	CLIP-seq
MIRT2462626	hsa-miR-150	CLIP-seq
MIRT1462045	hsa-miR-1976	CLIP-seq
MIRT1462046	hsa-miR-4279	CLIP-seq
MIRT1462047	hsa-miR-4722-3p	CLIP-seq
MIRT1462042	hsa-miR-498	CLIP-seq
MIRT1462029	hsa-miR-1343	CLIP-seq
MIRT2462626	hsa-miR-150	CLIP-seq
MIRT1462045	hsa-miR-1976	CLIP-seq
MIRT1462046	hsa-miR-4279	CLIP-seq
MIRT1462047	hsa-miR-4722-3p	CLIP-seq
MIRT1462042	hsa-miR-498	CLIP-seq
MIRT2653015	hsa-miR-1244	CLIP-seq
MIRT1462029	hsa-miR-1343	CLIP-seq
MIRT2462626	hsa-miR-150	CLIP-seq
MIRT1462045	hsa-miR-1976	CLIP-seq
MIRT1462046	hsa-miR-4279	CLIP-seq
MIRT2653016	hsa-miR-4703-3p	CLIP-seq
MIRT1462047	hsa-miR-4722-3p	CLIP-seq
MIRT1462042	hsa-miR-498	CLIP-seq
MIRT2653015	hsa-miR-1244	CLIP-seq
MIRT1462029	hsa-miR-1343	CLIP-seq
MIRT2462626	hsa-miR-150	CLIP-seq
MIRT1462045	hsa-miR-1976	CLIP-seq
MIRT1462046	hsa-miR-4279	CLIP-seq
MIRT1462047	hsa-miR-4722-3p	CLIP-seq
MIRT1462042	hsa-miR-498	CLIP-seq

Gene ontology (GO) Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001650	Component	Fibrillar center	IDA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IBA
GO:0003682	Function	Chromatin binding	IEA
GO:0005515	Function	Protein binding	IPI	28169274
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	7597036
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006353	Process	DNA-templated transcription termination	IEA
GO:0006353	Process	DNA-templated transcription termination	NAS	7597036
GO:0006360	Process	Transcription by RNA polymerase I	IEA
GO:0006361	Process	Transcription initiation at RNA polymerase I promoter	IEA
GO:0006363	Process	Termination of RNA polymerase I transcription	IBA
GO:0006363	Process	Termination of RNA polymerase I transcription	IEA
GO:0006363	Process	Termination of RNA polymerase I transcription	ISS
GO:0008156	Process	Negative regulation of DNA replication	IEA

Other IDs

• MIM: 600777
• HGNC: 12397
• e!Ensembl: ENSG00000125482

Protein

• UniProt ID: Q15361
• Protein name: Transcription termination factor 1 (TTF-1) (RNA polymerase I termination factor) (Transcription termination factor I) (TTF-I)
• Protein function: Multifunctional nucleolar protein that terminates ribosomal gene transcription, mediates replication fork arrest and regulates RNA polymerase I transcription on chromatin. Plays a dual role in rDNA regulation, being involved in both activation a
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13921	Myb_DNA-bind_6	620 → 677		Domain

• Sequence:

  MEGESSRFEIHTPVSDKKKKKCSIHKERPQKHSHEIFRDSSLVNEQSQITRRKKRKKDFQ
  HLISSPLKKSRICDETANATSTLKKRKKRRYSALEVDEEAGVTVVLVDKENINNTPKHFR
  KDVDVVCVDMSIEQKLPRKPKTDKFQVLAKSHAHKSEALHSKVREKKNKKHQRKAASWES
  QRARDTLPQSESHQEESWLSVGPGGEITELPASAHKNKSKKKKKKSSNREYETLAMPEGS
  QAGREAGTDMQESQPTVGLDDETPQLLGPTHKKKSKKKKKKKSNHQEFEALAMPEGSQVG
  SEVGADMQESRPAVGLHGETAGIPAPAYKNKSKKKKKKSNHQEFEAVAMPESLESAYPEG
  SQVGSEVGTVEGSTALKGFKESNSTKKKSKKRKLTSVKRARVSGDDFSVPSKNSESTLFD
  SVEGDGAMMEEGVKSRPRQKKTQACLASKHVQEAPRLEPANEEHNVETAEDSEIRYLSAD
  SGDADDSDADLGSAVKQLQEFIPNIKDRATSTIKRMYRDDLERFKEFKAQGVAIKFGKFS
  VKENKQLEKNVEDFLALTGIESADKLLYTDRYPEEKSVITNLKRRYSFRLHIGRNIARPW
  KLIYYRAKKMFDVNNYKGRYSEGDTEKLKMYHSLLGNDWKTIGEMVARSSLSVALKFSQI
  SSQRNRGAWSKSETRKLIKAVEEVILKKMSPQELKEVDSKLQENPESCLSIVREKLYKGI
  SWVEVEAKVQTRNWMQCKSKWTEILTKRMTNGRRIYYGMNALRAKVSLIERLYEINVEDT
  NEIDWEDLASAIGDVPPSYVQTKFSRLKAVYVPFWQKKTFPEIIDYLYETTLPLLKEKLE
  KMMEKKGTKIQTPAAPKQVFPFRDIFYYEDDSEGEDIEKESEGQAPCMAHACNSSTLGGQ
  GRWII

• Sequence length: 905

Pathways

KEGG Pathway	Reactome Pathway
Thyroid hormone synthesis	Surfactant metabolism
	RNA Polymerase I Transcription Initiation
	RNA Polymerase I Transcription Termination

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Hypothyroidism, congenital, nongoitrous, 2	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (118)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	10830305, 12051626, 12584565, 15084379, 16865260, 18320074, 18665037, 18932182, 19390995, 19620839, 21334718, 22036089, 22418245, 23026196, 23196793, 24029707, 24097870, 24456475, 25086987, 25337222, 25733373, 25926247, 25970685, 25982011, 26200450, 26256690, 26285240, 26657873, 26799356, 27258567, 28298147, 28378892, 28528511, 28730709, 29268402, 29296178, 29443782, 30035857, 30092812, 30718697, 31135446, 31206846, 31363481, 31646818, 31809668, 9061032		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	19040416, 19293183, 21036415, 21799026, 22011671, 22085929, 22439932, 22761434, 22824147, 23108025, 23143308, 23525704, 23763999, 23887294, 24097870, 24743427, 25337222, 25733373, 25935651, 26200450, 26725982, 26823891, 26912193, 27062706, 28192407, 28285961, 28555282, 28625636, 28677170, 28725929, 29508480, 29658609, 29956575, 30314701, 30348718, 30354850, 30389437, 30628926, 30894682, 30927189, 31135446, 31142791, 31196060, 31206846, 31428934, 31653481, 31782890, 31788765		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	25851810		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10401674, 31570790		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	8814700		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	BEFREE	10401674, 30723294, 8062273		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	29561759, 30075157		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	24913303, 37088465	Associate	★☆☆☆☆ Found in Text Mining only
Benign Hereditary Chorea	Benign Hereditary Chorea	BEFREE	17765926, 18445003, 24129101, 26723978		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	21325940		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	24913303, 31646818	Associate	★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	21325940		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19620839		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27983521	Associate	★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	15084379		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	33980985	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	25884169	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	29770932	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10401674, 15084379, 19620839, 26200450, 30148742, 31788765, 8814700		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	19506552	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	28731042, 30723294, 33761111	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	18246044	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	16862075, 23196793, 28884744, 33031101	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	18587322, 36745184	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	26575266	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	14729646, 18855882, 19037882, 22761434, 25982011, 26912193, 28325285, 29088717, 29407447, 29551766, 30169783, 30389437, 31142791, 31579090		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18246044, 27393506	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	16862075, 23358112	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	18932182, 30379223	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	23196793, 24594201, 27028392, 31263838, 35093316, 37338116, 38291083	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	28777147		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	20182342, 29180096, 30236546		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	22847723	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	28807344		★☆☆☆☆ Found in Text Mining only
Choreoathetosis Hypothyroidism And Neonatal Respiratory Distress	Choreoathetosis	Pubtator	18246044, 19887917, 24913303	Associate	★☆☆☆☆ Found in Text Mining only
Choreoathetosis, Hypothyroidism, And Neonatal Respiratory Distress	Choreoathetosis, Hypothyroidism, And Neonatal Respiratory Distress	BEFREE	24129101		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	15861215	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26036188, 28914964		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15861215	Associate	★☆☆☆☆ Found in Text Mining only
Congenital absence of lung	Congenital lung agenesis	BEFREE	11854318		★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	BEFREE	10830305		★☆☆☆☆ Found in Text Mining only
Congenital Hypothyroidism	Congenital Hypothyroidism	BEFREE	23997037, 7635972		★☆☆☆☆ Found in Text Mining only
Cutaneous Fibrous Histiocytoma	Fibrous Histiocytoma	BEFREE	15084379		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28745797		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	22460811	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	28777147		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	31809313		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	37962678	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	15912575		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24913303	Associate	★☆☆☆☆ Found in Text Mining only
hemangiopericytoma	Hemangiopericytoma	BEFREE	28295484		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	15548547		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	19037882, 30927038		★☆☆☆☆ Found in Text Mining only
Leigh syndrome French Canadian type	Leigh syndrome	Pubtator	25337222	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26821084, 27834930, 29328481		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	27834930, 29328481		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	19238079, 25337222, 31142791	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	30927038		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17925434, 19279207, 22185756, 24594201, 26912193, 27983521, 30379223, 31142791, 31983097, 9059352	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	19620839, 23625920, 28811082, 8814700		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	28843751		★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	7635972	Associate	★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	17115439		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19620839		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28745797		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	14729646, 18855882, 19037882, 22761434, 23625920, 25982011, 26912193, 28325285, 29088717, 29407447, 29551766, 30169783, 30389437, 31142791, 8814700		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26828696		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	30160089		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15832087, 21397355, 23763999, 26657873, 27834930, 28933335, 29407447, 29551766		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	10401674, 27409604		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	29594354, 31148874		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	15084379, 30354850		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	23041828	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	26939861	Associate	★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	15084379, 15087663, 23143308, 28776576		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	25143124		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	22011671		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18932182, 19620839, 20182342, 21148747, 22498723, 22572237, 23052371, 23143308, 23887161, 24509876, 25878335, 25884169, 25893822, 26036188, 26261681, 26469326, 28009606, 28065467, 28378892, 28777147, 28811082, 28843751, 28914964, 29079814, 29658609, 30067951, 30075157, 30379651		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	28933335		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	30558081		★☆☆☆☆ Found in Text Mining only
Neuroendocrine cell hyperplasia of infancy	Neuroendocrine Cell Hyperplasia	BEFREE	23787483, 27187870		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	30379651, 31133441		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18932182, 20471712, 22940844, 23064619, 25733373, 25854394, 26045746, 26337230, 26536195, 27013395, 27258567, 27992557, 28213001, 28378892, 28555282, 28730709, 28811082, 29069959, 29277771, 30499220, 30519330, 30798982, 31062864, 31285885, 31614634, 31782890, 8814700		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	27443515	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian mucinous tumor	Ovarian mucinous tumor	BEFREE	18665037		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24880093		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18246044, 27443515	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	19493635, 23052371, 26356687, 29408504, 29561759, 31653481		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	Pubtator	32668278	Associate	★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	28807344		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	31809313		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	18855882, 25337222		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26828696		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	28285791		★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Pulmonary alveolar proteinosis	Pubtator	24859540	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	29388718		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	21867529, 23997037		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	28643792		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	16862075, 17046168, 19390995, 23358112, 26799356, 28349943, 29088717, 29876935, 30045295, 30385371, 31263838, 31704153, 31782890		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	23358112, 25889870, 28349943, 31161851, 31263838, 31782890, 33011388, 36745184, 39392394, 9059352	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12051626, 15084379, 18932182, 21334718, 22228640, 23196793, 25733373, 25982011, 27258567, 28378892, 28538407, 29268512, 30798982, 30914778, 31206846, 31646818		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	30035857		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	36705380	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	19506552, 22498723, 24712572, 27573549, 30160089, 31788765, 9854590		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	34751390	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Dysgenesis	Thyroid Dysgenesis	BEFREE	11854318, 20302910		★☆☆☆☆ Found in Text Mining only
Thyroid Dyshormonogenesis 5	Thyroid Dyshormonogenesis	BEFREE	7635972		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	18246044		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	30160089, 31063281, 31788765, 8062273		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	18958156, 23358112, 31238008, 33813463, 36499466, 9854590	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	19506552	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	31713988		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	19506552, 23510370, 29381957, 31238008	Associate	★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	11854318		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28697743	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30628926		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	27389559, 28009606		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	19887917	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

CD3EAP 2 shared pathwaysRNA Polymerase I Transcription Termination, RNA Polymerase I Transcription Initiation Related via 2 shared pathways including RNA Polymerase I Transcription Termination, RNA Polymerase I Transcription Initiation. TWISTNB 2 shared pathwaysRNA Polymerase I Transcription Termination, RNA Polymerase I Transcription Initiation Related via 2 shared pathways including RNA Polymerase I Transcription Termination, RNA Polymerase I Transcription Initiation. ZNRD1 2 shared pathwaysRNA Polymerase I Transcription Termination, RNA Polymerase I Transcription Initiation Related via 2 shared pathways including RNA Polymerase I Transcription Termination, RNA Polymerase I Transcription Initiation. UBTF 2 shared pathwaysRNA Polymerase I Transcription Termination, RNA Polymerase I Transcription Initiation Related via 2 shared pathways including RNA Polymerase I Transcription Termination, RNA Polymerase I Transcription Initiation. TAF1D 2 shared pathwaysRNA Polymerase I Transcription Termination, RNA Polymerase I Transcription Initiation Related via 2 shared pathways including RNA Polymerase I Transcription Termination, RNA Polymerase I Transcription Initiation.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CD3EAP	0	[]	2	["RNA Polymerase I Transcription Termination","RNA Polymerase I Transcription Initiation"]	0	[]
TWISTNB	0	[]	2	["RNA Polymerase I Transcription Termination","RNA Polymerase I Transcription Initiation"]	0	[]
ZNRD1	0	[]	2	["RNA Polymerase I Transcription Termination","RNA Polymerase I Transcription Initiation"]	0	[]
UBTF	0	[]	2	["RNA Polymerase I Transcription Termination","RNA Polymerase I Transcription Initiation"]	0	[]
TAF1D	0	[]	2	["RNA Polymerase I Transcription Termination","RNA Polymerase I Transcription Initiation"]	0	[]

Diseases Linked via Similar Genes

Childhood-onset motor and cognitive regression syndrome with extrapyramidal movement disorder Linked via 1 of 5 related genesUBTF Neurodevelopmental disorder Linked via 1 of 5 related genesUBTF Parkinson disease Linked via 1 of 5 related genesUBTF Dermatologic disorder Linked via 1 of 5 related genesTAF1D Skin disease Linked via 1 of 5 related genesTAF1D

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Childhood-onset motor and cognitive regression syndrome with extrapyramidal movement disorder	1	["UBTF"]
Neurodevelopmental disorder	1	["UBTF"]
Parkinson disease	1	["UBTF"]
Dermatologic disorder	1	["TAF1D"]
Skin disease	1	["TAF1D"]