Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	203062
Gene name	T-SNARE domain containing 1
Gene symbol	TSNARE1
Synonyms (NCBI Gene)	-
Chromosome	8
Chromosome location	8q24.3

43 Show/Hide all (43)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017957	hsa-miR-335-5p	Microarray	18185580
MIRT514820	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT514819	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT514818	hsa-miR-3924	HITS-CLIP	21572407
MIRT514817	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT514820	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT514819	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT514818	hsa-miR-3924	HITS-CLIP	23313552
MIRT514817	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT514820	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT514819	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT514818	hsa-miR-3924	PAR-CLIP	20371350
MIRT514817	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT514820	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT514819	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT514818	hsa-miR-3924	PAR-CLIP	21572407
MIRT514817	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT514821	hsa-miR-1295b-3p	PAR-CLIP	23446348
MIRT514820	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT514819	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT514818	hsa-miR-3924	PAR-CLIP	23446348
MIRT514817	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT514820	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT514819	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT514818	hsa-miR-3924	HITS-CLIP	21572407
MIRT514817	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT514820	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT514819	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT514818	hsa-miR-3924	HITS-CLIP	23313552
MIRT514817	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT514820	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT514819	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT514818	hsa-miR-3924	PAR-CLIP	20371350
MIRT514817	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT514820	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT514819	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT514818	hsa-miR-3924	PAR-CLIP	21572407
MIRT514817	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT514821	hsa-miR-1295b-3p	PAR-CLIP	23446348
MIRT514820	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT514819	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT514818	hsa-miR-3924	PAR-CLIP	23446348
MIRT514817	hsa-miR-1277-5p	PAR-CLIP	23446348

10 Show/Hide all (10)

GO ID	Ontology	Definition	Evidence
GO:0000149	Function	SNARE binding	IBA
GO:0005484	Function	SNAP receptor activity	IBA
GO:0006886	Process	Intracellular protein transport	IBA
GO:0006906	Process	Vesicle fusion	IBA
GO:0008021	Component	Synaptic vesicle	IBA
GO:0012505	Component	Endomembrane system	IBA
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0031201	Component	SNARE complex	IBA
GO:0048278	Process	Vesicle docking	IBA

MIM	HGNC	e!Ensembl
620986	26437	ENSG00000171045

Q96NA8

Protein name

t-SNARE domain-containing protein 1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05739	SNARE	452 → 504	SNARE domain	Family
PF13873	Myb_DNA-bind_5	124 → 201	Myb/SANT-like DNA-binding domain	Domain
PF14523	Syntaxin_2	264 → 368	Syntaxin-like protein	Domain

Sequence

MSYGSIARGGGLGSRGPFGGPSRQGCQPLECARCWTEYGIRHFPCPSPESKLQNRCVGKD
GEGDLGPAGTPIVPRARKRGPGVAPEGSRMPEPTSSPTIGPRKDSAAGPHGRMAGPSTTR
AKKRKPNFCPQETEVLVSKVSKHHQLLFGTGLLKAEPTRRYRVWSRILQAVNALGYCRRD
VVDLKHKWRDLRAVVRRKLGDLRKAAHGPSPGSGKPQALALTPVEQVVAKTFSCQALPSE
GFSLEPPRATQVDPCNLQELFQEMSANVFRINSSVTSLERSLQSLGTPSDTQELRDSLHT
AQQETNKTIAASASSVKQMAELLRSSCPQERLQQERPQLDRLKTQLSDAIQCYGVVQKKI
AEKSRALLPMAQRGSKQSPQAPFAELADDEKVFNGSDNMWQGQEQALLPDITEEDLEAIR
LREEAILQMESNLLDVNQIIKDLASMVSEQGEAVDSIEASLEAASSHAEAARQLLAGASR
HQLQRHKIKCCFLSAGVTALLVIIIIIATSVRK

Sequence length

513

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (15)
ANOREXIA NERVOSA	—	GWAS catalog	31835028, 36137488	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	40645996	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	31835028, 33686288, 35764056, 38565336	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	28540026, 31835028, 33686288, 35764056	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	31835028, 32606422, 33479212, 34099189, 34159505	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	36753304	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	30626913, 30643256, 31835028	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	29942085, 30643256	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	36137488	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	31835028, 36137488	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	38637617	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	23974872, 25056061, 26198764, 28540026, 28991256, 29483656, 30285260, 30626913, 31268507, 31374203, 31740837, 31835028, 32606422, 33479212, 33686288, 34159505, 35396580, 36137488, 36753304, 39753749	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	31835028	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (9)
Anxiety	Anxiety Disorder	GWASCAT_DG	29942085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Pervasive	Development Disorder	GWASCAT_DG	28540026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	GWASCAT_DG	26252872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	30626913		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASDB_DG	23974872		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	23974872, 25056061, 26198764, 28540026, 28991256, 29483656, 30285260, 30626913, 31268507, 31374203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	24166486, 25471352, 31336035, 31548722		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	24166486		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	27668389, 34481484	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

TSNARE1 (t-SNARE domain containing 1)

Save This Analysis