TRMT5 (tRNA methyltransferase 5)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 57570
• Gene name: TRNA methyltransferase 5
• Gene symbol: TRMT5
• Synonyms (NCBI Gene): COXPD26, KIAA1393, PNSED, TRM5
• Chromosome: 14
• Chromosome location: 14q23.1
• Summary: tRNAs contain as many as 13 or 14 nucleotides that are modified posttranscriptionally by enzymes that are highly specific for particular nucleotides in the tRNA structure. TRMT5 methylates the N1 position of guanosine-37 (G37) in selected tRNAs using S-ad

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs746738473	C>A,T	Pathogenic	Coding sequence variant, missense variant
rs1057517685	T>C	Pathogenic	Missense variant, coding sequence variant

miRNA Show/Hide all (477)

miRTarBase ID	miRNA	Experiments	Reference
MIRT046645	hsa-miR-222-3p	CLASH	23622248
MIRT711674	hsa-miR-4686	HITS-CLIP	19536157
MIRT711673	hsa-miR-4720-5p	HITS-CLIP	19536157
MIRT711672	hsa-miR-4799-3p	HITS-CLIP	19536157
MIRT711671	hsa-miR-5588-5p	HITS-CLIP	19536157
MIRT711669	hsa-miR-4667-5p	HITS-CLIP	19536157
MIRT711670	hsa-miR-4700-5p	HITS-CLIP	19536157
MIRT711668	hsa-miR-8089	HITS-CLIP	19536157
MIRT711667	hsa-miR-637	HITS-CLIP	19536157
MIRT711666	hsa-miR-7155-5p	HITS-CLIP	19536157
MIRT711665	hsa-miR-103a-2-5p	HITS-CLIP	19536157
MIRT711664	hsa-miR-6828-5p	HITS-CLIP	19536157
MIRT711663	hsa-miR-4314	HITS-CLIP	19536157
MIRT711662	hsa-miR-4642	HITS-CLIP	19536157
MIRT564370	hsa-miR-548g-3p	PAR-CLIP	20371350
MIRT564369	hsa-miR-5586-5p	PAR-CLIP	20371350
MIRT564368	hsa-miR-4267	PAR-CLIP	20371350
MIRT564367	hsa-miR-3713	PAR-CLIP	20371350
MIRT564366	hsa-miR-4477a	PAR-CLIP	20371350
MIRT564365	hsa-miR-587	PAR-CLIP	20371350
MIRT465213	hsa-miR-3646	PAR-CLIP	23446348
MIRT465212	hsa-miR-5197-5p	PAR-CLIP	23446348
MIRT465211	hsa-miR-873-5p	PAR-CLIP	23446348
MIRT465208	hsa-miR-203a-3p	PAR-CLIP	23446348
MIRT465213	hsa-miR-3646	PAR-CLIP	23446348
MIRT465212	hsa-miR-5197-5p	PAR-CLIP	23446348
MIRT465211	hsa-miR-873-5p	PAR-CLIP	23446348
MIRT465209	hsa-miR-4671-5p	PAR-CLIP	23446348
MIRT465208	hsa-miR-203a-3p	PAR-CLIP	23446348
MIRT450480	hsa-miR-548a-3p	PAR-CLIP	22291592
MIRT450479	hsa-miR-548ar-3p	PAR-CLIP	22291592
MIRT450478	hsa-miR-548az-3p	PAR-CLIP	22291592
MIRT450477	hsa-miR-548e-3p	PAR-CLIP	22291592
MIRT450476	hsa-miR-548f-3p	PAR-CLIP	22291592
MIRT450474	hsa-miR-5582-3p	PAR-CLIP	22291592
MIRT450475	hsa-miR-3163	PAR-CLIP	22291592
MIRT450473	hsa-miR-153-5p	PAR-CLIP	22291592
MIRT450472	hsa-miR-20a-3p	PAR-CLIP	22291592
MIRT450471	hsa-miR-340-5p	PAR-CLIP	22291592
MIRT450470	hsa-miR-3161	PAR-CLIP	22291592
MIRT450469	hsa-miR-544a	PAR-CLIP	22291592
MIRT450468	hsa-miR-599	PAR-CLIP	22291592
MIRT465213	hsa-miR-3646	PAR-CLIP	23592263
MIRT465212	hsa-miR-5197-5p	PAR-CLIP	23592263
MIRT465211	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT465210	hsa-miR-4732-3p	PAR-CLIP	23592263
MIRT465209	hsa-miR-4671-5p	PAR-CLIP	23592263
MIRT465208	hsa-miR-203a-3p	PAR-CLIP	23592263
MIRT450480	hsa-miR-548a-3p	PAR-CLIP	22100165
MIRT450479	hsa-miR-548ar-3p	PAR-CLIP	22100165
MIRT450478	hsa-miR-548az-3p	PAR-CLIP	22100165
MIRT450477	hsa-miR-548e-3p	PAR-CLIP	22100165
MIRT450476	hsa-miR-548f-3p	PAR-CLIP	22100165
MIRT450474	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT450475	hsa-miR-3163	PAR-CLIP	22100165
MIRT450473	hsa-miR-153-5p	PAR-CLIP	22100165
MIRT450472	hsa-miR-20a-3p	PAR-CLIP	22100165
MIRT450471	hsa-miR-340-5p	PAR-CLIP	22100165
MIRT450470	hsa-miR-3161	PAR-CLIP	22100165
MIRT450469	hsa-miR-544a	PAR-CLIP	22100165
MIRT450468	hsa-miR-599	PAR-CLIP	22100165
MIRT711674	hsa-miR-4686	HITS-CLIP	19536157
MIRT711673	hsa-miR-4720-5p	HITS-CLIP	19536157
MIRT711672	hsa-miR-4799-3p	HITS-CLIP	19536157
MIRT711671	hsa-miR-5588-5p	HITS-CLIP	19536157
MIRT711669	hsa-miR-4667-5p	HITS-CLIP	19536157
MIRT711670	hsa-miR-4700-5p	HITS-CLIP	19536157
MIRT711668	hsa-miR-8089	HITS-CLIP	19536157
MIRT711667	hsa-miR-637	HITS-CLIP	19536157
MIRT711666	hsa-miR-7155-5p	HITS-CLIP	19536157
MIRT711665	hsa-miR-103a-2-5p	HITS-CLIP	19536157
MIRT711664	hsa-miR-6828-5p	HITS-CLIP	19536157
MIRT711663	hsa-miR-4314	HITS-CLIP	19536157
MIRT711662	hsa-miR-4642	HITS-CLIP	19536157
MIRT564370	hsa-miR-548g-3p	PAR-CLIP	20371350
MIRT564369	hsa-miR-5586-5p	PAR-CLIP	20371350
MIRT564368	hsa-miR-4267	PAR-CLIP	20371350
MIRT564367	hsa-miR-3713	PAR-CLIP	20371350
MIRT564366	hsa-miR-4477a	PAR-CLIP	20371350
MIRT564365	hsa-miR-587	PAR-CLIP	20371350
MIRT465213	hsa-miR-3646	PAR-CLIP	23446348
MIRT465212	hsa-miR-5197-5p	PAR-CLIP	23446348
MIRT465211	hsa-miR-873-5p	PAR-CLIP	23446348
MIRT465208	hsa-miR-203a-3p	PAR-CLIP	23446348
MIRT465213	hsa-miR-3646	PAR-CLIP	23446348
MIRT465212	hsa-miR-5197-5p	PAR-CLIP	23446348
MIRT465211	hsa-miR-873-5p	PAR-CLIP	23446348
MIRT465209	hsa-miR-4671-5p	PAR-CLIP	23446348
MIRT465208	hsa-miR-203a-3p	PAR-CLIP	23446348
MIRT450480	hsa-miR-548a-3p	PAR-CLIP	22291592
MIRT450479	hsa-miR-548ar-3p	PAR-CLIP	22291592
MIRT450478	hsa-miR-548az-3p	PAR-CLIP	22291592
MIRT450477	hsa-miR-548e-3p	PAR-CLIP	22291592
MIRT450476	hsa-miR-548f-3p	PAR-CLIP	22291592
MIRT450474	hsa-miR-5582-3p	PAR-CLIP	22291592
MIRT450475	hsa-miR-3163	PAR-CLIP	22291592
MIRT450473	hsa-miR-153-5p	PAR-CLIP	22291592
MIRT450472	hsa-miR-20a-3p	PAR-CLIP	22291592
MIRT450471	hsa-miR-340-5p	PAR-CLIP	22291592
MIRT450470	hsa-miR-3161	PAR-CLIP	22291592
MIRT450469	hsa-miR-544a	PAR-CLIP	22291592
MIRT450468	hsa-miR-599	PAR-CLIP	22291592
MIRT465213	hsa-miR-3646	PAR-CLIP	23592263
MIRT465212	hsa-miR-5197-5p	PAR-CLIP	23592263
MIRT465211	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT465210	hsa-miR-4732-3p	PAR-CLIP	23592263
MIRT465209	hsa-miR-4671-5p	PAR-CLIP	23592263
MIRT465208	hsa-miR-203a-3p	PAR-CLIP	23592263
MIRT450480	hsa-miR-548a-3p	PAR-CLIP	22100165
MIRT450479	hsa-miR-548ar-3p	PAR-CLIP	22100165
MIRT450478	hsa-miR-548az-3p	PAR-CLIP	22100165
MIRT450477	hsa-miR-548e-3p	PAR-CLIP	22100165
MIRT450476	hsa-miR-548f-3p	PAR-CLIP	22100165
MIRT450474	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT450475	hsa-miR-3163	PAR-CLIP	22100165
MIRT450473	hsa-miR-153-5p	PAR-CLIP	22100165
MIRT450472	hsa-miR-20a-3p	PAR-CLIP	22100165
MIRT450471	hsa-miR-340-5p	PAR-CLIP	22100165
MIRT450470	hsa-miR-3161	PAR-CLIP	22100165
MIRT450469	hsa-miR-544a	PAR-CLIP	22100165
MIRT450468	hsa-miR-599	PAR-CLIP	22100165
MIRT1456843	hsa-miR-106a	CLIP-seq
MIRT1456844	hsa-miR-106b	CLIP-seq
MIRT1456845	hsa-miR-1202	CLIP-seq
MIRT1456846	hsa-miR-1226	CLIP-seq
MIRT1456847	hsa-miR-1231	CLIP-seq
MIRT1456848	hsa-miR-1295	CLIP-seq
MIRT1456849	hsa-miR-142-5p	CLIP-seq
MIRT1456850	hsa-miR-17	CLIP-seq
MIRT1456851	hsa-miR-186	CLIP-seq
MIRT1456852	hsa-miR-198	CLIP-seq
MIRT1456853	hsa-miR-200b	CLIP-seq
MIRT1456854	hsa-miR-200c	CLIP-seq
MIRT1456855	hsa-miR-204	CLIP-seq
MIRT1456856	hsa-miR-20a	CLIP-seq
MIRT1456857	hsa-miR-20b	CLIP-seq
MIRT1456858	hsa-miR-21	CLIP-seq
MIRT1456859	hsa-miR-211	CLIP-seq
MIRT1456860	hsa-miR-2681	CLIP-seq
MIRT1456861	hsa-miR-3065-3p	CLIP-seq
MIRT1456862	hsa-miR-3133	CLIP-seq
MIRT1456863	hsa-miR-331-5p	CLIP-seq
MIRT1456864	hsa-miR-338-3p	CLIP-seq
MIRT1456865	hsa-miR-33a	CLIP-seq
MIRT1456866	hsa-miR-33b	CLIP-seq
MIRT1456867	hsa-miR-340	CLIP-seq
MIRT1456868	hsa-miR-3609	CLIP-seq
MIRT1456869	hsa-miR-3611	CLIP-seq
MIRT1456870	hsa-miR-3614-5p	CLIP-seq
MIRT1456871	hsa-miR-3616-5p	CLIP-seq
MIRT1456872	hsa-miR-3647-5p	CLIP-seq
MIRT1456873	hsa-miR-3925-3p	CLIP-seq
MIRT1456874	hsa-miR-3972	CLIP-seq
MIRT1456875	hsa-miR-3978	CLIP-seq
MIRT1456876	hsa-miR-4264	CLIP-seq
MIRT1456877	hsa-miR-429	CLIP-seq
MIRT1456878	hsa-miR-4302	CLIP-seq
MIRT1456879	hsa-miR-4446-5p	CLIP-seq
MIRT1456880	hsa-miR-4490	CLIP-seq
MIRT1456881	hsa-miR-450b-3p	CLIP-seq
MIRT1456882	hsa-miR-4519	CLIP-seq
MIRT1456883	hsa-miR-4530	CLIP-seq
MIRT1456884	hsa-miR-4645-3p	CLIP-seq
MIRT1456885	hsa-miR-4655-5p	CLIP-seq
MIRT1456886	hsa-miR-4678	CLIP-seq
MIRT1456887	hsa-miR-4704-3p	CLIP-seq
MIRT1456888	hsa-miR-4711-5p	CLIP-seq
MIRT1456889	hsa-miR-4713-3p	CLIP-seq
MIRT1456890	hsa-miR-4717-5p	CLIP-seq
MIRT1456891	hsa-miR-4733-3p	CLIP-seq
MIRT1456892	hsa-miR-4753-3p	CLIP-seq
MIRT1456893	hsa-miR-4755-5p	CLIP-seq
MIRT1456894	hsa-miR-4768-5p	CLIP-seq
MIRT1456895	hsa-miR-4787-5p	CLIP-seq
MIRT1456896	hsa-miR-4795-5p	CLIP-seq
MIRT1456897	hsa-miR-4796-3p	CLIP-seq
MIRT1456898	hsa-miR-4797-3p	CLIP-seq
MIRT1456899	hsa-miR-485-3p	CLIP-seq
MIRT1456900	hsa-miR-514	CLIP-seq
MIRT1456901	hsa-miR-514b-3p	CLIP-seq
MIRT1456902	hsa-miR-519d	CLIP-seq
MIRT1456903	hsa-miR-548ah	CLIP-seq
MIRT1456904	hsa-miR-548c-3p	CLIP-seq
MIRT1456905	hsa-miR-548g	CLIP-seq
MIRT1456906	hsa-miR-552	CLIP-seq
MIRT1456907	hsa-miR-573	CLIP-seq
MIRT1456908	hsa-miR-582-5p	CLIP-seq
MIRT1456909	hsa-miR-590-5p	CLIP-seq
MIRT1456910	hsa-miR-603	CLIP-seq
MIRT1456911	hsa-miR-607	CLIP-seq
MIRT1456912	hsa-miR-623	CLIP-seq
MIRT1456913	hsa-miR-638	CLIP-seq
MIRT1456914	hsa-miR-654-3p	CLIP-seq
MIRT1456915	hsa-miR-764	CLIP-seq
MIRT1456916	hsa-miR-766	CLIP-seq
MIRT1456917	hsa-miR-769-3p	CLIP-seq
MIRT1456918	hsa-miR-875-3p	CLIP-seq
MIRT1456919	hsa-miR-93	CLIP-seq
MIRT2136902	hsa-miR-1225-5p	CLIP-seq
MIRT2136903	hsa-miR-1248	CLIP-seq
MIRT2136904	hsa-miR-1253	CLIP-seq
MIRT2136905	hsa-miR-1285	CLIP-seq
MIRT2136906	hsa-miR-149	CLIP-seq
MIRT2136907	hsa-miR-1587	CLIP-seq
MIRT2136908	hsa-miR-15a	CLIP-seq
MIRT2136909	hsa-miR-15b	CLIP-seq
MIRT2136910	hsa-miR-16	CLIP-seq
MIRT2136911	hsa-miR-1909	CLIP-seq
MIRT2136912	hsa-miR-195	CLIP-seq
MIRT2136913	hsa-miR-202	CLIP-seq
MIRT1456855	hsa-miR-204	CLIP-seq
MIRT1456859	hsa-miR-211	CLIP-seq
MIRT2136914	hsa-miR-2113	CLIP-seq
MIRT2136915	hsa-miR-214	CLIP-seq
MIRT2136916	hsa-miR-23a	CLIP-seq
MIRT2136917	hsa-miR-23b	CLIP-seq
MIRT2136918	hsa-miR-23c	CLIP-seq
MIRT1456860	hsa-miR-2681	CLIP-seq
MIRT2136919	hsa-miR-3064-5p	CLIP-seq
MIRT2136920	hsa-miR-3119	CLIP-seq
MIRT2136921	hsa-miR-3127-3p	CLIP-seq
MIRT2136922	hsa-miR-3150a-5p	CLIP-seq
MIRT2136923	hsa-miR-3150b-5p	CLIP-seq
MIRT2136924	hsa-miR-3153	CLIP-seq
MIRT2136925	hsa-miR-3187-5p	CLIP-seq
MIRT2136926	hsa-miR-3192	CLIP-seq
MIRT2136927	hsa-miR-3194-3p	CLIP-seq
MIRT2136928	hsa-miR-34b	CLIP-seq
MIRT2136929	hsa-miR-361-3p	CLIP-seq
MIRT1456871	hsa-miR-3616-5p	CLIP-seq
MIRT2136930	hsa-miR-3619-5p	CLIP-seq
MIRT1456872	hsa-miR-3647-5p	CLIP-seq
MIRT2136931	hsa-miR-3679-3p	CLIP-seq
MIRT2136932	hsa-miR-3714	CLIP-seq
MIRT2136933	hsa-miR-377	CLIP-seq
MIRT2136934	hsa-miR-3919	CLIP-seq
MIRT2136935	hsa-miR-424	CLIP-seq
MIRT2136936	hsa-miR-4253	CLIP-seq
MIRT2136937	hsa-miR-4255	CLIP-seq
MIRT2136938	hsa-miR-4263	CLIP-seq
MIRT2136939	hsa-miR-4287	CLIP-seq
MIRT2136940	hsa-miR-4291	CLIP-seq
MIRT2136941	hsa-miR-4300	CLIP-seq
MIRT2136942	hsa-miR-4437	CLIP-seq
MIRT2136943	hsa-miR-4443	CLIP-seq
MIRT1456879	hsa-miR-4446-5p	CLIP-seq
MIRT2136944	hsa-miR-4469	CLIP-seq
MIRT1456880	hsa-miR-4490	CLIP-seq
MIRT2136945	hsa-miR-4502	CLIP-seq
MIRT2136946	hsa-miR-451b	CLIP-seq
MIRT2136947	hsa-miR-4524	CLIP-seq
MIRT2136948	hsa-miR-4528	CLIP-seq
MIRT2136949	hsa-miR-4539	CLIP-seq
MIRT1456885	hsa-miR-4655-5p	CLIP-seq
MIRT2136950	hsa-miR-4674	CLIP-seq
MIRT2136951	hsa-miR-4685-3p	CLIP-seq
MIRT2136952	hsa-miR-4693-3p	CLIP-seq
MIRT2136953	hsa-miR-4717-3p	CLIP-seq
MIRT2136954	hsa-miR-4722-5p	CLIP-seq
MIRT2136955	hsa-miR-4724-3p	CLIP-seq
MIRT1456892	hsa-miR-4753-3p	CLIP-seq
MIRT1456893	hsa-miR-4755-5p	CLIP-seq
MIRT1456894	hsa-miR-4768-5p	CLIP-seq
MIRT2136956	hsa-miR-4790-3p	CLIP-seq
MIRT2136957	hsa-miR-4794	CLIP-seq
MIRT1456896	hsa-miR-4795-5p	CLIP-seq
MIRT2136958	hsa-miR-4797-5p	CLIP-seq
MIRT2136959	hsa-miR-497	CLIP-seq
MIRT1456904	hsa-miR-548c-3p	CLIP-seq
MIRT1456905	hsa-miR-548g	CLIP-seq
MIRT2136960	hsa-miR-561	CLIP-seq
MIRT1456907	hsa-miR-573	CLIP-seq
MIRT2136961	hsa-miR-574-5p	CLIP-seq
MIRT2136962	hsa-miR-583	CLIP-seq
MIRT1456910	hsa-miR-603	CLIP-seq
MIRT1456911	hsa-miR-607	CLIP-seq
MIRT2136963	hsa-miR-612	CLIP-seq
MIRT2136964	hsa-miR-616	CLIP-seq
MIRT1456912	hsa-miR-623	CLIP-seq
MIRT2136965	hsa-miR-635	CLIP-seq
MIRT1456914	hsa-miR-654-3p	CLIP-seq
MIRT2136966	hsa-miR-657	CLIP-seq
MIRT2136967	hsa-miR-671-5p	CLIP-seq
MIRT2136968	hsa-miR-760	CLIP-seq
MIRT2136969	hsa-miR-761	CLIP-seq
MIRT2136970	hsa-miR-765	CLIP-seq
MIRT2136971	hsa-miR-873	CLIP-seq
MIRT2136972	hsa-miR-920	CLIP-seq
MIRT2136973	hsa-miR-922	CLIP-seq
MIRT2136974	hsa-miR-942	CLIP-seq
MIRT2357703	hsa-miR-10a	CLIP-seq
MIRT2357704	hsa-miR-10b	CLIP-seq
MIRT1456846	hsa-miR-1226	CLIP-seq
MIRT2357705	hsa-miR-1227	CLIP-seq
MIRT2357706	hsa-miR-1236	CLIP-seq
MIRT2357707	hsa-miR-1264	CLIP-seq
MIRT2136905	hsa-miR-1285	CLIP-seq
MIRT1456848	hsa-miR-1295	CLIP-seq
MIRT2357708	hsa-miR-132	CLIP-seq
MIRT2357709	hsa-miR-140-3p	CLIP-seq
MIRT2357710	hsa-miR-144	CLIP-seq
MIRT2357711	hsa-miR-181a	CLIP-seq
MIRT2357712	hsa-miR-181b	CLIP-seq
MIRT2357713	hsa-miR-181c	CLIP-seq
MIRT2357714	hsa-miR-181d	CLIP-seq
MIRT1456851	hsa-miR-186	CLIP-seq
MIRT2357715	hsa-miR-205	CLIP-seq
MIRT2357716	hsa-miR-212	CLIP-seq
MIRT2136916	hsa-miR-23a	CLIP-seq
MIRT2136917	hsa-miR-23b	CLIP-seq
MIRT2136918	hsa-miR-23c	CLIP-seq
MIRT1456860	hsa-miR-2681	CLIP-seq
MIRT2357717	hsa-miR-300	CLIP-seq
MIRT2136920	hsa-miR-3119	CLIP-seq
MIRT2136921	hsa-miR-3127-3p	CLIP-seq
MIRT2357718	hsa-miR-3143	CLIP-seq
MIRT2136925	hsa-miR-3187-5p	CLIP-seq
MIRT2357719	hsa-miR-324-5p	CLIP-seq
MIRT2357720	hsa-miR-339-5p	CLIP-seq
MIRT1456865	hsa-miR-33a	CLIP-seq
MIRT1456866	hsa-miR-33b	CLIP-seq
MIRT1456867	hsa-miR-340	CLIP-seq
MIRT1456870	hsa-miR-3614-5p	CLIP-seq
MIRT1456871	hsa-miR-3616-5p	CLIP-seq
MIRT1456872	hsa-miR-3647-5p	CLIP-seq
MIRT2357721	hsa-miR-3667-5p	CLIP-seq
MIRT2136933	hsa-miR-377	CLIP-seq
MIRT2357722	hsa-miR-381	CLIP-seq
MIRT2357723	hsa-miR-3945	CLIP-seq
MIRT1456875	hsa-miR-3978	CLIP-seq
MIRT2136936	hsa-miR-4253	CLIP-seq
MIRT2136937	hsa-miR-4255	CLIP-seq
MIRT2357724	hsa-miR-4262	CLIP-seq
MIRT2357725	hsa-miR-4276	CLIP-seq
MIRT2357726	hsa-miR-4279	CLIP-seq
MIRT2357727	hsa-miR-4281	CLIP-seq
MIRT1456878	hsa-miR-4302	CLIP-seq
MIRT2357728	hsa-miR-4421	CLIP-seq
MIRT2357729	hsa-miR-4422	CLIP-seq
MIRT2357730	hsa-miR-4434	CLIP-seq
MIRT1456880	hsa-miR-4490	CLIP-seq
MIRT2357731	hsa-miR-4516	CLIP-seq
MIRT2136946	hsa-miR-451b	CLIP-seq
MIRT1456885	hsa-miR-4655-5p	CLIP-seq
MIRT2357732	hsa-miR-4666-3p	CLIP-seq
MIRT2357733	hsa-miR-4666-5p	CLIP-seq
MIRT2357734	hsa-miR-4679	CLIP-seq
MIRT2357735	hsa-miR-4680-5p	CLIP-seq
MIRT2357736	hsa-miR-4684-3p	CLIP-seq
MIRT2357737	hsa-miR-4696	CLIP-seq
MIRT2357738	hsa-miR-4698	CLIP-seq
MIRT1456887	hsa-miR-4704-3p	CLIP-seq
MIRT1456890	hsa-miR-4717-5p	CLIP-seq
MIRT2357739	hsa-miR-4725-5p	CLIP-seq
MIRT1456891	hsa-miR-4733-3p	CLIP-seq
MIRT1456892	hsa-miR-4753-3p	CLIP-seq
MIRT1456894	hsa-miR-4768-5p	CLIP-seq
MIRT2357740	hsa-miR-4778-3p	CLIP-seq
MIRT1456896	hsa-miR-4795-5p	CLIP-seq
MIRT2357741	hsa-miR-504	CLIP-seq
MIRT2357742	hsa-miR-508-5p	CLIP-seq
MIRT2357743	hsa-miR-5096	CLIP-seq
MIRT2357744	hsa-miR-532-3p	CLIP-seq
MIRT2357745	hsa-miR-543	CLIP-seq
MIRT1456905	hsa-miR-548g	CLIP-seq
MIRT1456907	hsa-miR-573	CLIP-seq
MIRT1456908	hsa-miR-582-5p	CLIP-seq
MIRT2357746	hsa-miR-593	CLIP-seq
MIRT1456910	hsa-miR-603	CLIP-seq
MIRT1456911	hsa-miR-607	CLIP-seq
MIRT2136963	hsa-miR-612	CLIP-seq
MIRT2357747	hsa-miR-622	CLIP-seq
MIRT2136965	hsa-miR-635	CLIP-seq
MIRT2357748	hsa-miR-661	CLIP-seq
MIRT2357749	hsa-miR-664	CLIP-seq
MIRT1456916	hsa-miR-766	CLIP-seq
MIRT2357750	hsa-miR-890	CLIP-seq
MIRT2136974	hsa-miR-942	CLIP-seq
MIRT1456860	hsa-miR-2681	CLIP-seq
MIRT2136933	hsa-miR-377	CLIP-seq
MIRT2396382	hsa-miR-4272	CLIP-seq
MIRT1456880	hsa-miR-4490	CLIP-seq
MIRT1456885	hsa-miR-4655-5p	CLIP-seq
MIRT2396383	hsa-miR-4735-5p	CLIP-seq
MIRT2396384	hsa-miR-4760-3p	CLIP-seq
MIRT1456895	hsa-miR-4787-5p	CLIP-seq
MIRT1456910	hsa-miR-603	CLIP-seq
MIRT2136967	hsa-miR-671-5p	CLIP-seq
MIRT2357703	hsa-miR-10a	CLIP-seq
MIRT2357704	hsa-miR-10b	CLIP-seq
MIRT1456845	hsa-miR-1202	CLIP-seq
MIRT2136905	hsa-miR-1285	CLIP-seq
MIRT1456852	hsa-miR-198	CLIP-seq
MIRT2136916	hsa-miR-23a	CLIP-seq
MIRT2136917	hsa-miR-23b	CLIP-seq
MIRT2136918	hsa-miR-23c	CLIP-seq
MIRT2357718	hsa-miR-3143	CLIP-seq
MIRT2136925	hsa-miR-3187-5p	CLIP-seq
MIRT2357720	hsa-miR-339-5p	CLIP-seq
MIRT2651356	hsa-miR-3647-3p	CLIP-seq
MIRT2357721	hsa-miR-3667-5p	CLIP-seq
MIRT1456874	hsa-miR-3972	CLIP-seq
MIRT1456875	hsa-miR-3978	CLIP-seq
MIRT1456876	hsa-miR-4264	CLIP-seq
MIRT2357728	hsa-miR-4421	CLIP-seq
MIRT2651357	hsa-miR-4457	CLIP-seq
MIRT1456880	hsa-miR-4490	CLIP-seq
MIRT2136946	hsa-miR-451b	CLIP-seq
MIRT1456885	hsa-miR-4655-5p	CLIP-seq
MIRT2357737	hsa-miR-4696	CLIP-seq
MIRT2357739	hsa-miR-4725-5p	CLIP-seq
MIRT1456895	hsa-miR-4787-5p	CLIP-seq
MIRT1456898	hsa-miR-4797-3p	CLIP-seq
MIRT2357741	hsa-miR-504	CLIP-seq
MIRT2357742	hsa-miR-508-5p	CLIP-seq
MIRT2357743	hsa-miR-5096	CLIP-seq
MIRT2651358	hsa-miR-513b	CLIP-seq
MIRT2357745	hsa-miR-543	CLIP-seq
MIRT2651359	hsa-miR-548ac	CLIP-seq
MIRT2651360	hsa-miR-548ae	CLIP-seq
MIRT2651361	hsa-miR-548aj	CLIP-seq
MIRT2651362	hsa-miR-548am	CLIP-seq
MIRT2651363	hsa-miR-548d-3p	CLIP-seq
MIRT2651364	hsa-miR-548x	CLIP-seq
MIRT2651365	hsa-miR-548z	CLIP-seq
MIRT1456906	hsa-miR-552	CLIP-seq
MIRT2357746	hsa-miR-593	CLIP-seq
MIRT1456910	hsa-miR-603	CLIP-seq
MIRT2136963	hsa-miR-612	CLIP-seq
MIRT2357748	hsa-miR-661	CLIP-seq
MIRT1456915	hsa-miR-764	CLIP-seq
MIRT1456916	hsa-miR-766	CLIP-seq
MIRT1456918	hsa-miR-875-3p	CLIP-seq
MIRT2357703	hsa-miR-10a	CLIP-seq
MIRT2357704	hsa-miR-10b	CLIP-seq
MIRT1456845	hsa-miR-1202	CLIP-seq
MIRT2136905	hsa-miR-1285	CLIP-seq
MIRT1456852	hsa-miR-198	CLIP-seq
MIRT2136916	hsa-miR-23a	CLIP-seq
MIRT2136917	hsa-miR-23b	CLIP-seq
MIRT2136918	hsa-miR-23c	CLIP-seq
MIRT2357718	hsa-miR-3143	CLIP-seq
MIRT2136925	hsa-miR-3187-5p	CLIP-seq
MIRT2357720	hsa-miR-339-5p	CLIP-seq
MIRT2651356	hsa-miR-3647-3p	CLIP-seq
MIRT2357721	hsa-miR-3667-5p	CLIP-seq
MIRT1456874	hsa-miR-3972	CLIP-seq
MIRT1456875	hsa-miR-3978	CLIP-seq
MIRT1456876	hsa-miR-4264	CLIP-seq
MIRT2357728	hsa-miR-4421	CLIP-seq
MIRT2651357	hsa-miR-4457	CLIP-seq
MIRT1456880	hsa-miR-4490	CLIP-seq
MIRT2136946	hsa-miR-451b	CLIP-seq
MIRT1456885	hsa-miR-4655-5p	CLIP-seq
MIRT2357737	hsa-miR-4696	CLIP-seq
MIRT2357739	hsa-miR-4725-5p	CLIP-seq
MIRT1456898	hsa-miR-4797-3p	CLIP-seq
MIRT2357741	hsa-miR-504	CLIP-seq
MIRT2357742	hsa-miR-508-5p	CLIP-seq
MIRT2357743	hsa-miR-5096	CLIP-seq
MIRT2651358	hsa-miR-513b	CLIP-seq
MIRT2357745	hsa-miR-543	CLIP-seq
MIRT2651359	hsa-miR-548ac	CLIP-seq
MIRT2651360	hsa-miR-548ae	CLIP-seq
MIRT2651361	hsa-miR-548aj	CLIP-seq
MIRT2651362	hsa-miR-548am	CLIP-seq
MIRT2651363	hsa-miR-548d-3p	CLIP-seq
MIRT2651364	hsa-miR-548x	CLIP-seq
MIRT2651365	hsa-miR-548z	CLIP-seq
MIRT1456906	hsa-miR-552	CLIP-seq
MIRT2357746	hsa-miR-593	CLIP-seq
MIRT1456910	hsa-miR-603	CLIP-seq
MIRT2136963	hsa-miR-612	CLIP-seq
MIRT2357748	hsa-miR-661	CLIP-seq
MIRT1456915	hsa-miR-764	CLIP-seq
MIRT1456916	hsa-miR-766	CLIP-seq
MIRT1456918	hsa-miR-875-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002939	Process	TRNA N1-guanine methylation	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IBA
GO:0005759	Component	Mitochondrial matrix	IDA	26189817
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0008033	Process	TRNA processing	IEA
GO:0008168	Function	Methyltransferase activity	IEA
GO:0008175	Function	TRNA methyltransferase activity	IBA
GO:0016740	Function	Transferase activity	IEA
GO:0030488	Process	TRNA methylation	IEA
GO:0032259	Process	Methylation	IEA
GO:0052906	Function	TRNA (guanine(37)-N1)-methyltransferase activity	IEA
GO:0070901	Process	Mitochondrial tRNA methylation	IBA
GO:0070901	Process	Mitochondrial tRNA methylation	IEA
GO:0070901	Process	Mitochondrial tRNA methylation	IMP	26189817

Other IDs

• MIM: 611023
• HGNC: 23141
• e!Ensembl: ENSG00000126814

Protein

• UniProt ID: Q32P41
• Protein name: tRNA (guanine(37)-N(1))-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) (tRNA methyltransferase 5 homolog)
• Protein function: Involved in mitochondrial tRNA methylation (PubMed:26189817). Specifically methylates the N1 position of guanosine-37 in various tRNAs. Methylation is not dependent on the nature of the nucleoside 5' of the target nucleoside. This is the first s
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02475	Met_10	198 → 419	Met-10+ like-protein	Family

• Sequence:

  MVLWILWRPFGFSGRFLKLESHSITESKSLIPVAWTSLTQMLLEAPGIFLLGQRKRFSTM
  PETETHERETELFSPPSDVRGMTKLDRTAFKKTVNIPVLKVRKEIVSKLMRSLKRAALQR
  PGIRRVIEDPEDKESRLIMLDPYKIFTHDSFEKAELSVLEQLNVSPQISKYNLELTYEHF
  KSEEILRAVLPEGQDVTSGFSRIGHIAHLNLRDHQLSFKHLIGQVMIDKNPGITSAVNKI
  NNIDNMYRNFQMEVLSGEQNMMTKVRENNYTYEFDFSKVYWNPRLSTEHSRITELLKPGD
  VLFDVFAGVGPFAIPVAKKNCTVFANDLNPESHKWLLYNCKLNKVDQKVKVFNLDGKDFL
  QGPVKEELMQLLGLSKERKPSVHVVMNLPAKAIEFLSAFKWLLDGQPCSSEFLPIVHCYS
  FSKDANPAEDVRQRAGAVLGISLEACSSVHLVRNVAPNKEMLCITFQIPASVLYKNQTRN
  PENHEDPPLKRQRTAEAFSDEKTQIVSNT

• Sequence length: 509

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Combined oxidative phosphorylation defect type 26	Likely pathogenic; Pathogenic	rs1443616611, rs1057517685	RCV002510311 RCV000412548	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (20)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Acute myeloid leukemia	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual disability	Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Uncertain significance; Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL DISEASE	—	ClinGen, GWAS catalog	26189817, 29021354, 35342985, 35460901	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL DISEASES	—	Disgenet, ClinGen	ClinGen report	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY WITH VARIABLE SPASTICITY, EXERCISE INTOLERANCE, AND DEVELOPMENTAL DELAY	—	CTD, HPO CTD, HPO	26189817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRMT5-related disorder	Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (20)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acidosis Lactic	Lactic acidosis	Pubtator	26189817	Associate	★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36632750	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36632750	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	26189817	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	35109800	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Combined oxidative phosphorylation defect type 26	Combined Oxidative Phosphorylation Deficiency	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 26	Combined Oxidative Phosphorylation Deficiency	GENOMICS_ENGLAND_DG	26189817, 29021354		★☆☆☆☆ Found in Text Mining only
COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 26	Combined Oxidative Phosphorylation Deficiency	ORPHANET_DG	26189817		★☆☆☆☆ Found in Text Mining only
COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 26	Combined Oxidative Phosphorylation Deficiency	UNIPROT_DG	26189817		★☆☆☆☆ Found in Text Mining only
COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 26	Combined Oxidative Phosphorylation Deficiency	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 26	Combined Oxidative Phosphorylation Deficiency	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	33398350	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Microstomia	Microstomia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	26189817	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial Respiratory Chain Deficiencies	Mitochondrial Respiratory Chain Deficiencies	BEFREE	26189817		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

VARS2 2 shared diseasesCombined oxidative phosphorylation deficiency, Mitochondrial disease 7 shared evidence sourcesClinVar (Combined oxidative phosphorylation deficiency), Disgenet (Combined oxidative phosphorylation deficiency), Orphanet (Combined oxidative phosphorylation deficiency), GWAS catalog (Combined oxidative phosphorylation deficiency), ClinGen (Mitochondrial disease), GWAS catalog (Mitochondrial disease), Disgenet (Mitochondrial disease) Related via 2 shared diseases including Combined oxidative phosphorylation deficiency, Mitochondrial disease — evidence mostly Disgenet. C1QBP 2 shared diseasesCombined oxidative phosphorylation deficiency, Mitochondrial disease 6 shared evidence sourcesClinVar (Combined oxidative phosphorylation deficiency), Disgenet (Combined oxidative phosphorylation deficiency), GWAS catalog (Combined oxidative phosphorylation deficiency), ClinGen (Mitochondrial disease), GWAS catalog (Mitochondrial disease), Disgenet (Mitochondrial disease) Related via 2 shared diseases including Combined oxidative phosphorylation deficiency, Mitochondrial disease — evidence mostly Disgenet. MRPS16 2 shared diseasesCombined oxidative phosphorylation deficiency, Mitochondrial disease 6 shared evidence sourcesClinVar (Combined oxidative phosphorylation deficiency), Disgenet (Combined oxidative phosphorylation deficiency), Orphanet (Combined oxidative phosphorylation deficiency), GWAS catalog (Combined oxidative phosphorylation deficiency), ClinGen (Mitochondrial disease), Disgenet (Mitochondrial disease) Related via 2 shared diseases including Combined oxidative phosphorylation deficiency, Mitochondrial disease — evidence mostly Disgenet. MRPL3 2 shared diseasesCombined oxidative phosphorylation deficiency, Mitochondrial disease 6 shared evidence sourcesClinVar (Combined oxidative phosphorylation deficiency), Disgenet (Combined oxidative phosphorylation deficiency), Orphanet (Combined oxidative phosphorylation deficiency), GWAS catalog (Combined oxidative phosphorylation deficiency), ClinGen (Mitochondrial disease), Disgenet (Mitochondrial disease) Related via 2 shared diseases including Combined oxidative phosphorylation deficiency, Mitochondrial disease — evidence mostly Disgenet. TRMT10C 2 shared diseasesCombined oxidative phosphorylation deficiency, Mitochondrial disease 6 shared evidence sourcesClinVar (Combined oxidative phosphorylation deficiency), Disgenet (Combined oxidative phosphorylation deficiency), Orphanet (Combined oxidative phosphorylation deficiency), GWAS catalog (Combined oxidative phosphorylation deficiency), ClinGen (Mitochondrial disease), Disgenet (Mitochondrial disease) Related via 2 shared diseases including Combined oxidative phosphorylation deficiency, Mitochondrial disease — evidence mostly Disgenet.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
VARS2	2	["Combined oxidative phosphorylation deficiency","Mitochondrial disease"]	0	[]	7	["ClinVar (Combined oxidative phosphorylation deficiency)","Disgenet (Combined oxidative phosphorylation deficiency)","Orphanet (Combined oxidative phosphorylation deficiency)","GWAS catalog (Combined oxidative phosphorylation deficiency)","ClinGen (Mitochondrial disease)","GWAS catalog (Mitochondrial disease)","Disgenet (Mitochondrial disease)"]
C1QBP	2	["Combined oxidative phosphorylation deficiency","Mitochondrial disease"]	0	[]	6	["ClinVar (Combined oxidative phosphorylation deficiency)","Disgenet (Combined oxidative phosphorylation deficiency)","GWAS catalog (Combined oxidative phosphorylation deficiency)","ClinGen (Mitochondrial disease)","GWAS catalog (Mitochondrial disease)","Disgenet (Mitochondrial disease)"]
MRPS16	2	["Combined oxidative phosphorylation deficiency","Mitochondrial disease"]	0	[]	6	["ClinVar (Combined oxidative phosphorylation deficiency)","Disgenet (Combined oxidative phosphorylation deficiency)","Orphanet (Combined oxidative phosphorylation deficiency)","GWAS catalog (Combined oxidative phosphorylation deficiency)","ClinGen (Mitochondrial disease)","Disgenet (Mitochondrial disease)"]
MRPL3	2	["Combined oxidative phosphorylation deficiency","Mitochondrial disease"]	0	[]	6	["ClinVar (Combined oxidative phosphorylation deficiency)","Disgenet (Combined oxidative phosphorylation deficiency)","Orphanet (Combined oxidative phosphorylation deficiency)","GWAS catalog (Combined oxidative phosphorylation deficiency)","ClinGen (Mitochondrial disease)","Disgenet (Mitochondrial disease)"]
TRMT10C	2	["Combined oxidative phosphorylation deficiency","Mitochondrial disease"]	0	[]	6	["ClinVar (Combined oxidative phosphorylation deficiency)","Disgenet (Combined oxidative phosphorylation deficiency)","Orphanet (Combined oxidative phosphorylation deficiency)","GWAS catalog (Combined oxidative phosphorylation deficiency)","ClinGen (Mitochondrial disease)","Disgenet (Mitochondrial disease)"]

Diseases Linked via Similar Genes

Obstructive pulmonary disease Linked via 1 of 5 related genesVARS2 Gout Linked via 1 of 5 related genesVARS2 Hypothyroidism Linked via 1 of 5 related genesVARS2 Neurodevelopmental disorder Linked via 1 of 5 related genesVARS2 Psoriasis Linked via 1 of 5 related genesVARS2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Obstructive pulmonary disease	1	["VARS2"]
Gout	1	["VARS2"]
Hypothyroidism	1	["VARS2"]
Neurodevelopmental disorder	1	["VARS2"]
Psoriasis	1	["VARS2"]