TRHDE (thyrotropin releasing hormone degrading enzyme)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 29953
• Gene name: Thyrotropin releasing hormone degrading enzyme
• Gene symbol: TRHDE
• Synonyms (NCBI Gene): PAP-II, PGPEP2, TRH-DE
• Chromosome: 12
• Chromosome location: 12q21.1
• Summary: This gene encodes a member of the peptidase M1 family. The encoded protein is an extracellular peptidase that specifically cleaves and inactivates the neuropeptide thyrotropin-releasing hormone.[provided by RefSeq, Dec 2008]

miRNA Show/Hide all (38)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1452507	hsa-miR-148a	CLIP-seq
MIRT1452508	hsa-miR-148b	CLIP-seq
MIRT1452509	hsa-miR-152	CLIP-seq
MIRT1452510	hsa-miR-223	CLIP-seq
MIRT1452511	hsa-miR-3668	CLIP-seq
MIRT1452512	hsa-miR-4697-3p	CLIP-seq
MIRT1452513	hsa-miR-4773	CLIP-seq
MIRT2135504	hsa-miR-133a	CLIP-seq
MIRT2135505	hsa-miR-133b	CLIP-seq
MIRT2135506	hsa-miR-3120-3p	CLIP-seq
MIRT2135507	hsa-miR-486-5p	CLIP-seq
MIRT2356661	hsa-miR-187	CLIP-seq
MIRT2356662	hsa-miR-2278	CLIP-seq
MIRT2356663	hsa-miR-3692	CLIP-seq
MIRT2356664	hsa-miR-4711-3p	CLIP-seq
MIRT2462308	hsa-miR-122	CLIP-seq
MIRT2462309	hsa-miR-3165	CLIP-seq
MIRT2462310	hsa-miR-3664-3p	CLIP-seq
MIRT2462311	hsa-miR-548ac	CLIP-seq
MIRT2462312	hsa-miR-548d-3p	CLIP-seq
MIRT2462313	hsa-miR-548z	CLIP-seq
MIRT2462314	hsa-miR-873	CLIP-seq
MIRT2462308	hsa-miR-122	CLIP-seq
MIRT2462309	hsa-miR-3165	CLIP-seq
MIRT2462310	hsa-miR-3664-3p	CLIP-seq
MIRT2462311	hsa-miR-548ac	CLIP-seq
MIRT2462312	hsa-miR-548d-3p	CLIP-seq
MIRT2462313	hsa-miR-548z	CLIP-seq
MIRT2462314	hsa-miR-873	CLIP-seq
MIRT2650143	hsa-miR-1303	CLIP-seq
MIRT2650144	hsa-miR-194	CLIP-seq
MIRT2650145	hsa-miR-34c-3p	CLIP-seq
MIRT2650146	hsa-miR-3614-5p	CLIP-seq
MIRT2650147	hsa-miR-4696	CLIP-seq
MIRT2650148	hsa-miR-4711-5p	CLIP-seq
MIRT2650143	hsa-miR-1303	CLIP-seq
MIRT2650146	hsa-miR-3614-5p	CLIP-seq
MIRT2650147	hsa-miR-4696	CLIP-seq

Gene ontology (GO) Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004177	Function	Aminopeptidase activity	IEA
GO:0004177	Function	Aminopeptidase activity	TAS	10491199
GO:0005615	Component	Extracellular space	IBA
GO:0005886	Component	Plasma membrane	TAS	10491199
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0007165	Process	Signal transduction	TAS	10491199
GO:0007267	Process	Cell-cell signaling	TAS	10491199
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016920	Function	Pyroglutamyl-peptidase activity	IEA
GO:0043171	Process	Peptide catabolic process	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0070006	Function	Metalloaminopeptidase activity	IBA
GO:0070062	Component	Extracellular exosome	HDA	23533145

Other IDs

• MIM: 606950
• HGNC: 30748
• e!Ensembl: ENSG00000072657

Protein

• UniProt ID: Q9UKU6
• Protein name: Thyrotropin-releasing hormone-degrading ectoenzyme (TRH-DE) (TRH-degrading ectoenzyme) (EC 3.4.19.6) (Pyroglutamyl-peptidase II) (PAP-II) (TRH-specific aminopeptidase) (Thyroliberinase)
• Protein function: Specific inactivation of TRH after its release.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01433	Peptidase_M1	368 → 591	Peptidase family M1 domain	Domain
  PF11838	ERAP1_C	678 → 1005	ERAP1-like C-terminal domain	Domain
  PF17900	Peptidase_M1_N	146 → 331		Domain

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in brain.
• Sequence:

  MGEDDAALRAGSRGLSDPWADSVGVRPRTTERHIAVHKRLVLAFAVSLVALLAVTMLAVL
  LSLRFDECGASATPGADGGPSGFPERGGNGSLPGSARRNHHAGGDSWQPEAGGVASPGTT
  SAQPPSEEEREPWEPWTQLRLSGHLKPLHYNLMLTAFMENFTFSGEVNVEIACRNATRYV
  VLHASRVAVEKVQLAEDRAFGAVPVAGFFLYPQTQVLVVVLNRTLDAQRNYNLKIIYNAL
  IENELLGFFRSSYVLHGERRFLGVTQFSPTHARKAFPCFDEPIYKATFKISIKHQATYLS
  LSNMPVETSVFEEDGWVTDHFSQTPLMSTYYLAWAICNFTYRETTTKSGVVVRLYARPDA
  IRRGSGDYALHITKRLIEFYEDYFKVPYSLPKLDLLAVPKHPYAAMENWGLSIFVEQRIL
  LDPSVSSISYLLDVTMVIVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEFVGTDYLYPG
  WNMEKQRFLTDVLHEVMLLDGLASSHPVSQEVLQATDIDRVFDWIAYKKGAALIRMLANF
  MGHSVFQRGLQDYLTIHKYGNAARNDLWNTLSEALKRNGKYVNIQEVMDQWTLQMGYPVI
  TILGNTTAENRIIITQQHFIYDISAKTKALKLQNNSYLWQIPLTIVVGNRSHVSSEAIIW
  VSNKSEHHRITYLDKGSWLLGNINQTGYFRVNYDLRNWRLLIDQLIRNHEVLSVSNRAGL
  IDDAFSLARAGYLPQNIPLEIIRYLSEEKDFLPWHAASRALYPLDKLLDRMENYNIFNEY
  ILKQVATTYIKLGWPKNNFNGSLVQASYQHEELRREVIMLACSFGNKHCHQQASTLISDW
  ISSNRNRIPLNVRDIVYCTGVSLLDEDVWEFIWMKFHSTTAVSEKKILLEALTCSDDRNL
  LNRLLNLSLNSEVVLDQDAIDVIIHVARNPHGRDLAWKFFRDKWKILNTRYGEALFMNSK
  LISGVTEFLNTEGELKELKNFMKNYDGVAAASFSRAVETVEANVRWKMLYQDELFQWLGK
  ALRH

• Sequence length: 1024

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (13)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ANOREXIA NERVOSA	—	GWAS catalog	36137488	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	34446935, 36137488	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL ULCER	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT syndrome	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	29071344, 30643256	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	30643256	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	36137488	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	36137488	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	21452313	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	35396580, 36137488	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	34446935	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	21452313	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37247276	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

WTAP 2 shared diseasesEsophageal disease, Esophageal ulcer 2 shared evidence sourcesGWAS catalog (Esophageal disease), GWAS catalog (Esophageal ulcer) Related via 2 shared diseases including Esophageal disease, Esophageal ulcer — evidence mostly GWAS catalog. C8orf90 2 shared diseasesAnorexia nervosa, Obsessive-compulsive disorder 2 shared evidence sourcesGWAS catalog (Anorexia nervosa), GWAS catalog (Obsessive-compulsive disorder) Related via 2 shared diseases including Anorexia nervosa, Obsessive-compulsive disorder — evidence mostly GWAS catalog. CAMKK2 2 shared diseasesAnorexia nervosa, Obsessive-compulsive disorder 2 shared evidence sourcesGWAS catalog (Anorexia nervosa), GWAS catalog (Obsessive-compulsive disorder) Related via 2 shared diseases including Anorexia nervosa, Obsessive-compulsive disorder — evidence mostly GWAS catalog. DGKI 2 shared diseasesAnorexia nervosa, Obsessive-compulsive disorder 2 shared evidence sourcesGWAS catalog (Anorexia nervosa), GWAS catalog (Obsessive-compulsive disorder) Related via 2 shared diseases including Anorexia nervosa, Obsessive-compulsive disorder — evidence mostly GWAS catalog. HSPE1-MOB4 2 shared diseasesAnorexia nervosa, Obsessive-compulsive disorder 2 shared evidence sourcesGWAS catalog (Anorexia nervosa), GWAS catalog (Obsessive-compulsive disorder) Related via 2 shared diseases including Anorexia nervosa, Obsessive-compulsive disorder — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
WTAP	2	["Esophageal disease","Esophageal ulcer"]	0	[]	2	["GWAS catalog (Esophageal disease)","GWAS catalog (Esophageal ulcer)"]
C8orf90	2	["Anorexia nervosa","Obsessive-compulsive disorder"]	0	[]	2	["GWAS catalog (Anorexia nervosa)","GWAS catalog (Obsessive-compulsive disorder)"]
CAMKK2	2	["Anorexia nervosa","Obsessive-compulsive disorder"]	0	[]	2	["GWAS catalog (Anorexia nervosa)","GWAS catalog (Obsessive-compulsive disorder)"]
DGKI	2	["Anorexia nervosa","Obsessive-compulsive disorder"]	0	[]	2	["GWAS catalog (Anorexia nervosa)","GWAS catalog (Obsessive-compulsive disorder)"]
HSPE1-MOB4	2	["Anorexia nervosa","Obsessive-compulsive disorder"]	0	[]	2	["GWAS catalog (Anorexia nervosa)","GWAS catalog (Obsessive-compulsive disorder)"]

Diseases Linked via Similar Genes

Autism Linked via 3 of 5 related genesC8orf90, DGKI, HSPE1-MOB4 Bipolar disorder Linked via 3 of 5 related genesC8orf90, DGKI, HSPE1-MOB4 Tourette syndrome Linked via 3 of 5 related genesC8orf90, DGKI, HSPE1-MOB4 Diabetes mellitus type 2 Linked via 3 of 5 related genesC8orf90, CAMKK2, DGKI Prostate cancer Linked via 2 of 5 related genesWTAP, DGKI

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Autism	3	["C8orf90","DGKI","HSPE1-MOB4"]
Bipolar disorder	3	["C8orf90","DGKI","HSPE1-MOB4"]
Tourette syndrome	3	["C8orf90","DGKI","HSPE1-MOB4"]
Diabetes mellitus type 2	3	["C8orf90","CAMKK2","DGKI"]
Prostate cancer	2	["WTAP","DGKI"]