Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	10645
Gene name	Calcium/calmodulin dependent protein kinase kinase 2
Gene symbol	CAMKK2
Synonyms (NCBI Gene)	CAMKKCAMKKB
Chromosome	12
Chromosome location	12q24.31
Summary	The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. The major isoform of this gene plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosph

264

Show/Hide all (264)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027179	hsa-miR-103a-3p	Sequencing	20371350
MIRT031851	hsa-miR-16-5p	Sequencing	20371350
MIRT048541	hsa-miR-100-5p	CLASH	23622248
MIRT045326	hsa-miR-185-5p	CLASH	23622248
MIRT688870	hsa-miR-6854-5p	HITS-CLIP	23313552
MIRT688869	hsa-miR-5584-5p	HITS-CLIP	23313552
MIRT688868	hsa-miR-6750-5p	HITS-CLIP	23313552
MIRT688867	hsa-miR-6822-5p	HITS-CLIP	23313552
MIRT688866	hsa-miR-9500	HITS-CLIP	23313552
MIRT688865	hsa-miR-1288-5p	HITS-CLIP	23313552
MIRT688864	hsa-miR-4330	HITS-CLIP	23313552
MIRT688863	hsa-miR-3664-3p	HITS-CLIP	23313552
MIRT688862	hsa-miR-1289	HITS-CLIP	23313552
MIRT688861	hsa-miR-4294	HITS-CLIP	23313552
MIRT688860	hsa-miR-8078	HITS-CLIP	23313552
MIRT688859	hsa-miR-7847-3p	HITS-CLIP	23313552
MIRT688858	hsa-miR-3911	HITS-CLIP	23313552
MIRT688857	hsa-miR-644a	HITS-CLIP	23313552
MIRT688856	hsa-miR-5100	HITS-CLIP	23313552
MIRT688855	hsa-miR-579-3p	HITS-CLIP	23313552
MIRT688854	hsa-miR-664b-3p	HITS-CLIP	23313552
MIRT688853	hsa-miR-3198	HITS-CLIP	23313552
MIRT688852	hsa-miR-4309	HITS-CLIP	23313552
MIRT688851	hsa-miR-6818-5p	HITS-CLIP	23313552
MIRT688850	hsa-miR-147a	HITS-CLIP	23313552
MIRT688870	hsa-miR-6854-5p	HITS-CLIP	23313552
MIRT688869	hsa-miR-5584-5p	HITS-CLIP	23313552
MIRT688868	hsa-miR-6750-5p	HITS-CLIP	23313552
MIRT688867	hsa-miR-6822-5p	HITS-CLIP	23313552
MIRT688866	hsa-miR-9500	HITS-CLIP	23313552
MIRT688865	hsa-miR-1288-5p	HITS-CLIP	23313552
MIRT688864	hsa-miR-4330	HITS-CLIP	23313552
MIRT688863	hsa-miR-3664-3p	HITS-CLIP	23313552
MIRT688862	hsa-miR-1289	HITS-CLIP	23313552
MIRT688861	hsa-miR-4294	HITS-CLIP	23313552
MIRT688860	hsa-miR-8078	HITS-CLIP	23313552
MIRT688859	hsa-miR-7847-3p	HITS-CLIP	23313552
MIRT688858	hsa-miR-3911	HITS-CLIP	23313552
MIRT688857	hsa-miR-644a	HITS-CLIP	23313552
MIRT688856	hsa-miR-5100	HITS-CLIP	23313552
MIRT688855	hsa-miR-579-3p	HITS-CLIP	23313552
MIRT688854	hsa-miR-664b-3p	HITS-CLIP	23313552
MIRT688853	hsa-miR-3198	HITS-CLIP	23313552
MIRT688852	hsa-miR-4309	HITS-CLIP	23313552
MIRT688851	hsa-miR-6818-5p	HITS-CLIP	23313552
MIRT688850	hsa-miR-147a	HITS-CLIP	23313552
MIRT860471	hsa-miR-1275	CLIP-seq
MIRT860472	hsa-miR-140-5p	CLIP-seq
MIRT860473	hsa-miR-198	CLIP-seq
MIRT860474	hsa-miR-342-5p	CLIP-seq
MIRT860475	hsa-miR-409-5p	CLIP-seq
MIRT860476	hsa-miR-4447	CLIP-seq
MIRT860477	hsa-miR-4472	CLIP-seq
MIRT860478	hsa-miR-4481	CLIP-seq
MIRT860479	hsa-miR-4525	CLIP-seq
MIRT860480	hsa-miR-4651	CLIP-seq
MIRT860481	hsa-miR-4664-5p	CLIP-seq
MIRT860482	hsa-miR-4665-5p	CLIP-seq
MIRT860483	hsa-miR-4723-5p	CLIP-seq
MIRT860484	hsa-miR-4729	CLIP-seq
MIRT860485	hsa-miR-4745-5p	CLIP-seq
MIRT860486	hsa-miR-4757-3p	CLIP-seq
MIRT860487	hsa-miR-4758-5p	CLIP-seq
MIRT860488	hsa-miR-608	CLIP-seq
MIRT860489	hsa-miR-625	CLIP-seq
MIRT860490	hsa-miR-122	CLIP-seq
MIRT860491	hsa-miR-1587	CLIP-seq
MIRT860492	hsa-miR-4280	CLIP-seq
MIRT860493	hsa-miR-4492	CLIP-seq
MIRT860494	hsa-miR-4498	CLIP-seq
MIRT860495	hsa-miR-4656	CLIP-seq
MIRT860496	hsa-miR-4674	CLIP-seq
MIRT860497	hsa-miR-4675	CLIP-seq
MIRT860498	hsa-miR-4711-3p	CLIP-seq
MIRT860499	hsa-miR-4741	CLIP-seq
MIRT860500	hsa-miR-4778-3p	CLIP-seq
MIRT860501	hsa-miR-635	CLIP-seq
MIRT860502	hsa-miR-762	CLIP-seq
MIRT860503	hsa-miR-1200	CLIP-seq
MIRT860504	hsa-miR-127-5p	CLIP-seq
MIRT860505	hsa-miR-1305	CLIP-seq
MIRT860506	hsa-miR-132	CLIP-seq
MIRT860507	hsa-miR-153	CLIP-seq
MIRT860508	hsa-miR-154	CLIP-seq
MIRT860509	hsa-miR-1913	CLIP-seq
MIRT860510	hsa-miR-1972	CLIP-seq
MIRT860511	hsa-miR-212	CLIP-seq
MIRT860512	hsa-miR-3074-5p	CLIP-seq
MIRT860513	hsa-miR-3159	CLIP-seq
MIRT860514	hsa-miR-3189-5p	CLIP-seq
MIRT860515	hsa-miR-3194-5p	CLIP-seq
MIRT860516	hsa-miR-324-3p	CLIP-seq
MIRT860517	hsa-miR-331-3p	CLIP-seq
MIRT860518	hsa-miR-3690	CLIP-seq
MIRT860519	hsa-miR-380	CLIP-seq
MIRT860520	hsa-miR-411	CLIP-seq
MIRT860521	hsa-miR-421	CLIP-seq
MIRT860522	hsa-miR-4254	CLIP-seq
MIRT860523	hsa-miR-4292	CLIP-seq
MIRT860524	hsa-miR-4313	CLIP-seq
MIRT860525	hsa-miR-4640-5p	CLIP-seq
MIRT860526	hsa-miR-4652-3p	CLIP-seq
MIRT860527	hsa-miR-4684-5p	CLIP-seq
MIRT860528	hsa-miR-4691-3p	CLIP-seq
MIRT860529	hsa-miR-4709-5p	CLIP-seq
MIRT860530	hsa-miR-4717-3p	CLIP-seq
MIRT860531	hsa-miR-4726-5p	CLIP-seq
MIRT860532	hsa-miR-4731-3p	CLIP-seq
MIRT860533	hsa-miR-4733-3p	CLIP-seq
MIRT860534	hsa-miR-4738-3p	CLIP-seq
MIRT860535	hsa-miR-4755-3p	CLIP-seq
MIRT860536	hsa-miR-4758-3p	CLIP-seq
MIRT860537	hsa-miR-4801	CLIP-seq
MIRT860538	hsa-miR-4802-3p	CLIP-seq
MIRT860539	hsa-miR-671-5p	CLIP-seq
MIRT860540	hsa-miR-942	CLIP-seq
MIRT1922654	hsa-miR-299-3p	CLIP-seq
MIRT1922655	hsa-miR-3151	CLIP-seq
MIRT1922656	hsa-miR-3607-5p	CLIP-seq
MIRT1922657	hsa-miR-3692	CLIP-seq
MIRT860476	hsa-miR-4447	CLIP-seq
MIRT860477	hsa-miR-4472	CLIP-seq
MIRT1922658	hsa-miR-4736	CLIP-seq
MIRT1922659	hsa-miR-486-3p	CLIP-seq
MIRT1922660	hsa-miR-491-5p	CLIP-seq
MIRT1955332	hsa-miR-1245b-3p	CLIP-seq
MIRT860504	hsa-miR-127-5p	CLIP-seq
MIRT1955333	hsa-miR-129-5p	CLIP-seq
MIRT1955334	hsa-miR-2355-3p	CLIP-seq
MIRT1955335	hsa-miR-3127-3p	CLIP-seq
MIRT1955336	hsa-miR-3202	CLIP-seq
MIRT1955337	hsa-miR-362-5p	CLIP-seq
MIRT1955338	hsa-miR-4533	CLIP-seq
MIRT1955339	hsa-miR-4646-3p	CLIP-seq
MIRT860530	hsa-miR-4717-3p	CLIP-seq
MIRT1955340	hsa-miR-500b	CLIP-seq
MIRT1955341	hsa-miR-501-5p	CLIP-seq
MIRT1955342	hsa-miR-1184	CLIP-seq
MIRT1955343	hsa-miR-1301	CLIP-seq
MIRT1955335	hsa-miR-3127-3p	CLIP-seq
MIRT1955344	hsa-miR-3148	CLIP-seq
MIRT1955345	hsa-miR-3160-5p	CLIP-seq
MIRT1955346	hsa-miR-3179	CLIP-seq
MIRT860515	hsa-miR-3194-5p	CLIP-seq
MIRT1922657	hsa-miR-3692	CLIP-seq
MIRT1955347	hsa-miR-4461	CLIP-seq
MIRT860534	hsa-miR-4738-3p	CLIP-seq
MIRT1955348	hsa-miR-4797-5p	CLIP-seq
MIRT1955349	hsa-miR-5047	CLIP-seq
MIRT1955350	hsa-miR-627	CLIP-seq
MIRT860539	hsa-miR-671-5p	CLIP-seq
MIRT2193089	hsa-miR-1179	CLIP-seq
MIRT1955342	hsa-miR-1184	CLIP-seq
MIRT2193090	hsa-miR-1207-3p	CLIP-seq
MIRT2193091	hsa-miR-1234	CLIP-seq
MIRT860504	hsa-miR-127-5p	CLIP-seq
MIRT2193092	hsa-miR-1283	CLIP-seq
MIRT2193093	hsa-miR-1299	CLIP-seq
MIRT860505	hsa-miR-1305	CLIP-seq
MIRT2193094	hsa-miR-1323	CLIP-seq
MIRT2193095	hsa-miR-185	CLIP-seq
MIRT860473	hsa-miR-198	CLIP-seq
MIRT2193096	hsa-miR-2355-5p	CLIP-seq
MIRT2193097	hsa-miR-3135b	CLIP-seq
MIRT860513	hsa-miR-3159	CLIP-seq
MIRT2193098	hsa-miR-3190	CLIP-seq
MIRT860515	hsa-miR-3194-5p	CLIP-seq
MIRT2193099	hsa-miR-338-3p	CLIP-seq
MIRT2193100	hsa-miR-3646	CLIP-seq
MIRT2193101	hsa-miR-3662	CLIP-seq
MIRT2193102	hsa-miR-3667-5p	CLIP-seq
MIRT2193103	hsa-miR-378	CLIP-seq
MIRT2193104	hsa-miR-378b	CLIP-seq
MIRT2193105	hsa-miR-378c	CLIP-seq
MIRT2193106	hsa-miR-378d	CLIP-seq
MIRT2193107	hsa-miR-378e	CLIP-seq
MIRT2193108	hsa-miR-378f	CLIP-seq
MIRT2193109	hsa-miR-378h	CLIP-seq
MIRT2193110	hsa-miR-378i	CLIP-seq
MIRT2193111	hsa-miR-3919	CLIP-seq
MIRT2193112	hsa-miR-3938	CLIP-seq
MIRT2193113	hsa-miR-3943	CLIP-seq
MIRT2193114	hsa-miR-422a	CLIP-seq
MIRT2193115	hsa-miR-4267	CLIP-seq
MIRT2193116	hsa-miR-4306	CLIP-seq
MIRT2193117	hsa-miR-4310	CLIP-seq
MIRT860524	hsa-miR-4313	CLIP-seq
MIRT2193118	hsa-miR-4323	CLIP-seq
MIRT2193119	hsa-miR-4638-3p	CLIP-seq
MIRT2193120	hsa-miR-4644	CLIP-seq
MIRT860530	hsa-miR-4717-3p	CLIP-seq
MIRT2193121	hsa-miR-4782-5p	CLIP-seq
MIRT1955348	hsa-miR-4797-5p	CLIP-seq
MIRT2193122	hsa-miR-490-5p	CLIP-seq
MIRT2193123	hsa-miR-494	CLIP-seq
MIRT2193124	hsa-miR-512-3p	CLIP-seq
MIRT2193125	hsa-miR-516b	CLIP-seq
MIRT2193126	hsa-miR-520d-5p	CLIP-seq
MIRT2193127	hsa-miR-524-5p	CLIP-seq
MIRT2193128	hsa-miR-548aa	CLIP-seq
MIRT2193129	hsa-miR-548o	CLIP-seq
MIRT2193130	hsa-miR-598	CLIP-seq
MIRT2193131	hsa-miR-634	CLIP-seq
MIRT2193132	hsa-miR-7	CLIP-seq
MIRT2193133	hsa-miR-766	CLIP-seq
MIRT860518	hsa-miR-3690	CLIP-seq
MIRT860522	hsa-miR-4254	CLIP-seq
MIRT860539	hsa-miR-671-5p	CLIP-seq
MIRT2446145	hsa-miR-1228	CLIP-seq
MIRT2446146	hsa-miR-1253	CLIP-seq
MIRT2446147	hsa-miR-140-3p	CLIP-seq
MIRT2446148	hsa-miR-342-3p	CLIP-seq
MIRT2446149	hsa-miR-4251	CLIP-seq
MIRT2446150	hsa-miR-4329	CLIP-seq
MIRT2496170	hsa-miR-105	CLIP-seq
MIRT2496171	hsa-miR-1256	CLIP-seq
MIRT2496172	hsa-miR-1266	CLIP-seq
MIRT2496173	hsa-miR-29a	CLIP-seq
MIRT2496174	hsa-miR-29b	CLIP-seq
MIRT2496175	hsa-miR-29c	CLIP-seq
MIRT2496176	hsa-miR-3119	CLIP-seq
MIRT2496177	hsa-miR-3140-3p	CLIP-seq
MIRT2496178	hsa-miR-3194-3p	CLIP-seq
MIRT2496179	hsa-miR-3689d	CLIP-seq
MIRT2496180	hsa-miR-4436b-5p	CLIP-seq
MIRT2496181	hsa-miR-4487	CLIP-seq
MIRT2496182	hsa-miR-4518	CLIP-seq
MIRT2496183	hsa-miR-4660	CLIP-seq
MIRT860534	hsa-miR-4738-3p	CLIP-seq
MIRT2496184	hsa-miR-4753-5p	CLIP-seq
MIRT2193123	hsa-miR-494	CLIP-seq
MIRT2496185	hsa-miR-548c-3p	CLIP-seq
MIRT860539	hsa-miR-671-5p	CLIP-seq
MIRT2496186	hsa-miR-873	CLIP-seq
MIRT2496187	hsa-miR-885-3p	CLIP-seq
MIRT1955332	hsa-miR-1245b-3p	CLIP-seq
MIRT2496172	hsa-miR-1266	CLIP-seq
MIRT2677340	hsa-miR-1268	CLIP-seq
MIRT2677341	hsa-miR-1268b	CLIP-seq
MIRT2677342	hsa-miR-133a	CLIP-seq
MIRT2677343	hsa-miR-133b	CLIP-seq
MIRT2677344	hsa-miR-188-3p	CLIP-seq
MIRT2496173	hsa-miR-29a	CLIP-seq
MIRT2496174	hsa-miR-29b	CLIP-seq
MIRT2496175	hsa-miR-29c	CLIP-seq
MIRT2677345	hsa-miR-3115	CLIP-seq
MIRT2496179	hsa-miR-3689d	CLIP-seq
MIRT2677346	hsa-miR-3908	CLIP-seq
MIRT2677347	hsa-miR-3942-5p	CLIP-seq
MIRT2677348	hsa-miR-4281	CLIP-seq
MIRT2496180	hsa-miR-4436b-5p	CLIP-seq
MIRT2496182	hsa-miR-4518	CLIP-seq
MIRT2677349	hsa-miR-4703-5p	CLIP-seq
MIRT860534	hsa-miR-4738-3p	CLIP-seq
MIRT2496184	hsa-miR-4753-5p	CLIP-seq
MIRT2677350	hsa-miR-4766-3p	CLIP-seq
MIRT2496185	hsa-miR-548c-3p	CLIP-seq
MIRT2677351	hsa-miR-556-5p	CLIP-seq
MIRT2677352	hsa-miR-585	CLIP-seq
MIRT2677353	hsa-miR-610	CLIP-seq
MIRT2677354	hsa-miR-621	CLIP-seq
MIRT860539	hsa-miR-671-5p	CLIP-seq
MIRT2193132	hsa-miR-7	CLIP-seq
MIRT2496186	hsa-miR-873	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS	11395482
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004683	Function	Calcium/calmodulin-dependent protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	TAS	11395482
GO:0005509	Function	Calcium ion binding	IDA	11395482
GO:0005516	Function	Calmodulin binding	IEA
GO:0005516	Function	Calmodulin binding	TAS	11395482
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IMP	26103054
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	IDA	11395482
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019722	Process	Calcium-mediated signaling	TAS	11395482
GO:0034614	Process	Cellular response to reactive oxygen species	TAS	26103054
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0045859	Process	Regulation of protein kinase activity	TAS	11395482
GO:0045893	Process	Positive regulation of DNA-templated transcription	TAS	11395482
GO:0046777	Process	Protein autophosphorylation	IDA	11395482
GO:0061762	Process	CAMKK-AMPK signaling cascade	IBA
GO:0061762	Process	CAMKK-AMPK signaling cascade	IMP	26103054
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1903599	Process	Positive regulation of autophagy of mitochondrion	IMP	26103054

MIM	HGNC	e!Ensembl
615002	1470	ENSG00000110931

Q96RR4

Protein name

Calcium/calmodulin-dependent protein kinase kinase 2 (CaM-KK 2) (CaM-kinase kinase 2) (CaMKK 2) (EC 2.7.11.17) (Calcium/calmodulin-dependent protein kinase kinase beta) (CaM-KK beta) (CaM-kinase kinase beta) (CaMKK beta)

Protein function

Calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade involved in a number of cellular processes. Isoform 1, isoform 2 and isoform 3 phosphorylate CAMK1 and CAMK4. Isoform 3 phosphorylates CAMK1D

PDB

2ZV2 , 5UY6 , 5UYJ , 5VT1 , 5YV8 , 5YV9 , 5YVA , 5YVB , 5YVC , 6BKU , 6BLE , 6BQL , 6BQP , 6BQQ , 6BRC , 6CMJ , 6EF5 , 6EWW , 6FEL , 6Y3O , 6Y4K , 6Y6B , 6Y8A , 8TUC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	165 → 446	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed with higher levels in the brain. Intermediate levels are detected in spleen, prostate, thyroid and leukocytes. The lowest level is in lung. {ECO:0000269|PubMed:9662074}.

Sequence

MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEP
GCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGR
CICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVK
LAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAIL
KKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGI
EYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLS
ETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLK
DLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPS
LATVILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKKPTRECESLSELKEARQRRQP
PGHRPAPRGGGGSALVRGSPCVESCWAPAPGSPARMHPLRPEEAMEPE

Sequence length

588

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (68)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of large intestine	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Agoraphobia	Agoraphobia	BEFREE	17197037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	26395653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	33082841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	26395653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	23754392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	23754392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behavior Disorders	Behavior Disorders	BEFREE	26395653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	26354101, 26395653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	33082841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	27171399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28600513, 31164648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37661833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	34725334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29249655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28634229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	22662160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	38082327	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	24859760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	29358691	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29358691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	29358691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31402399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	30081955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29992499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	22334678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27012733, 27171399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27012733, 40715243	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	35438341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	Pubtator	18249060	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	22662160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37661833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	22662160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	34943872	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25847065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31164648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	25847065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29249655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28634229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	28634229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21098087, 21602788, 22549914, 22654108, 25394900, 26552607, 26734992, 29967592, 30242113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	28634229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25756516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29649512, 30525042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	26395653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	17236200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	34563205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	38082327	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	34293937	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25756516, 29133590, 29563610, 29914450, 30274374, 31164648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	21957496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28924233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22334678		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	BEFREE	23408651		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28634229		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	28634229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28634229, 35309839	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	21098087, 21602788, 22549914, 22654108, 25394900, 26552607, 26734992, 29967592, 30242113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21098087, 25394900, 29431615	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	28634229		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	23958956, 26354101, 26395653, 27004598, 28230171, 30525042		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	23958956		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia Spectrum and Other Psychotic Disorders	Schizophrenia	Pubtator	28737528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensory neuropathy	Sensory neuropathy	BEFREE	26785644, 29428485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30797785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25756516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25756516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31744495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CAMKK2 (calcium/calmodulin dependent protein kinase kinase 2)