Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	63970
Gene name	Tumor protein p53 regulated apoptosis inducing protein 1
Gene symbol	TP53AIP1
Synonyms (NCBI Gene)	P53AIP1
Chromosome	11
Chromosome location	11q24.3
Summary	This gene is specifically expressed in the thymus, and encodes a protein that is localized to the mitochondrion. The expression of this gene is inducible by p53, and it is thought to play an important role in mediating p53-dependent apoptosis. Alternative

40 Show/Hide all (40)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017230	hsa-miR-335-5p	Microarray	18185580
MIRT1448053	hsa-miR-1972	CLIP-seq
MIRT1448054	hsa-miR-3130-3p	CLIP-seq
MIRT1448055	hsa-miR-4645-5p	CLIP-seq
MIRT1448056	hsa-miR-4673	CLIP-seq
MIRT1448057	hsa-miR-4742-5p	CLIP-seq
MIRT1448058	hsa-miR-4755-3p	CLIP-seq
MIRT1448059	hsa-miR-4793-3p	CLIP-seq
MIRT2355106	hsa-miR-122	CLIP-seq
MIRT2355107	hsa-miR-1289	CLIP-seq
MIRT2355108	hsa-miR-3135b	CLIP-seq
MIRT2355109	hsa-miR-3198	CLIP-seq
MIRT2355110	hsa-miR-3652	CLIP-seq
MIRT2355111	hsa-miR-4294	CLIP-seq
MIRT2355112	hsa-miR-4309	CLIP-seq
MIRT2355113	hsa-miR-4430	CLIP-seq
MIRT2355114	hsa-miR-4534	CLIP-seq
MIRT2355115	hsa-miR-4695-3p	CLIP-seq
MIRT2355106	hsa-miR-122	CLIP-seq
MIRT2462175	hsa-miR-1273f	CLIP-seq
MIRT2355107	hsa-miR-1289	CLIP-seq
MIRT2462176	hsa-miR-143	CLIP-seq
MIRT2355108	hsa-miR-3135b	CLIP-seq
MIRT2355109	hsa-miR-3198	CLIP-seq
MIRT2355110	hsa-miR-3652	CLIP-seq
MIRT2355111	hsa-miR-4294	CLIP-seq
MIRT2355112	hsa-miR-4309	CLIP-seq
MIRT2355113	hsa-miR-4430	CLIP-seq
MIRT2355114	hsa-miR-4534	CLIP-seq
MIRT2462177	hsa-miR-4708-5p	CLIP-seq
MIRT2462178	hsa-miR-4770	CLIP-seq
MIRT2462175	hsa-miR-1273f	CLIP-seq
MIRT2355107	hsa-miR-1289	CLIP-seq
MIRT2462176	hsa-miR-143	CLIP-seq
MIRT2355109	hsa-miR-3198	CLIP-seq
MIRT2355111	hsa-miR-4294	CLIP-seq
MIRT2355112	hsa-miR-4309	CLIP-seq
MIRT2355114	hsa-miR-4534	CLIP-seq
MIRT2462177	hsa-miR-4708-5p	CLIP-seq
MIRT2462178	hsa-miR-4770	CLIP-seq

GO ID	Ontology	Definition	Evidence	Reference
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	11030628
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	11030628

MIM	HGNC	e!Ensembl
605426	29984	ENSG00000120471

Protein name

p53-regulated apoptosis-inducing protein 1 (p53AIP1)

Protein function

May play an important role in mediating p53/TP53-dependent apoptosis.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15338	TPIP1	2 → 124	p53-regulated apoptosis-inducing protein 1	Family

Tissue specificity

TISSUE SPECIFICITY: Only found to be expressed in thymus. {ECO:0000269|PubMed:11030628}.

Sequence

MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSDPLVLGAQVHG
GCRGIEALSVSSGSWSSATVWILTGLGLGLSRPFLPGATVLRDRPLGSAFELSYDQKKAP
LRLQ

Sequence length

124

Interactions

View interactions

KEGG Pathway	Reactome Pathway
p53 signaling pathway	TP53 Regulates Transcription of Genes Involved in Cytochrome C Release
Apoptosis

TP53AIP1 (tumor protein p53 regulated apoptosis inducing protein 1)