TMEM132A (transmembrane protein 132A)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 54972
• Gene name: Transmembrane protein 132A
• Gene symbol: TMEM132A
• Synonyms (NCBI Gene): GBP, HSPA5BP1
• Chromosome: 11
• Chromosome location: 11q12.2
• Summary: This gene encodes a protein that is highly similar to the rat Grp78-binding protein (GBP). Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

miRNA Show/Hide all (125)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029146	hsa-miR-26b-5p	Microarray	19088304
MIRT039799	hsa-miR-615-3p	CLASH	23622248
MIRT054731	hsa-miR-29c-3p	Microarray, qRT-PCR	24590289
MIRT1430702	hsa-miR-203	CLIP-seq
MIRT1430703	hsa-miR-522	CLIP-seq
MIRT2350697	hsa-miR-1193	CLIP-seq
MIRT2350698	hsa-miR-1207-5p	CLIP-seq
MIRT2350699	hsa-miR-1254	CLIP-seq
MIRT2350700	hsa-miR-1275	CLIP-seq
MIRT2350701	hsa-miR-1289	CLIP-seq
MIRT2350702	hsa-miR-1909	CLIP-seq
MIRT2350703	hsa-miR-24	CLIP-seq
MIRT2350704	hsa-miR-2467-3p	CLIP-seq
MIRT2350705	hsa-miR-2861	CLIP-seq
MIRT2350706	hsa-miR-29a	CLIP-seq
MIRT2350707	hsa-miR-29b	CLIP-seq
MIRT2350708	hsa-miR-29c	CLIP-seq
MIRT2350709	hsa-miR-3065-5p	CLIP-seq
MIRT2350710	hsa-miR-3116	CLIP-seq
MIRT2350711	hsa-miR-3144-5p	CLIP-seq
MIRT2350712	hsa-miR-3151	CLIP-seq
MIRT2350713	hsa-miR-3936	CLIP-seq
MIRT2350714	hsa-miR-4253	CLIP-seq
MIRT2350715	hsa-miR-4265	CLIP-seq
MIRT2350716	hsa-miR-4296	CLIP-seq
MIRT2350717	hsa-miR-4322	CLIP-seq
MIRT2350718	hsa-miR-4436b-3p	CLIP-seq
MIRT2350719	hsa-miR-4447	CLIP-seq
MIRT2350720	hsa-miR-4472	CLIP-seq
MIRT2350721	hsa-miR-4514	CLIP-seq
MIRT2350722	hsa-miR-4525	CLIP-seq
MIRT2350723	hsa-miR-4645-5p	CLIP-seq
MIRT2350724	hsa-miR-4652-5p	CLIP-seq
MIRT2350725	hsa-miR-4665-5p	CLIP-seq
MIRT2350726	hsa-miR-4673	CLIP-seq
MIRT2350727	hsa-miR-4688	CLIP-seq
MIRT2350728	hsa-miR-4692	CLIP-seq
MIRT2350729	hsa-miR-4723-5p	CLIP-seq
MIRT2350730	hsa-miR-4763-3p	CLIP-seq
MIRT2350731	hsa-miR-486-3p	CLIP-seq
MIRT2350732	hsa-miR-491-5p	CLIP-seq
MIRT1430703	hsa-miR-522	CLIP-seq
MIRT2350733	hsa-miR-625	CLIP-seq
MIRT2350734	hsa-miR-890	CLIP-seq
MIRT2350735	hsa-miR-940	CLIP-seq
MIRT2350697	hsa-miR-1193	CLIP-seq
MIRT2350698	hsa-miR-1207-5p	CLIP-seq
MIRT2350699	hsa-miR-1254	CLIP-seq
MIRT2350700	hsa-miR-1275	CLIP-seq
MIRT2350701	hsa-miR-1289	CLIP-seq
MIRT2644242	hsa-miR-1908	CLIP-seq
MIRT2350702	hsa-miR-1909	CLIP-seq
MIRT2350703	hsa-miR-24	CLIP-seq
MIRT2350704	hsa-miR-2467-3p	CLIP-seq
MIRT2644243	hsa-miR-2467-5p	CLIP-seq
MIRT2350705	hsa-miR-2861	CLIP-seq
MIRT2350706	hsa-miR-29a	CLIP-seq
MIRT2350707	hsa-miR-29b	CLIP-seq
MIRT2350708	hsa-miR-29c	CLIP-seq
MIRT2350709	hsa-miR-3065-5p	CLIP-seq
MIRT2350710	hsa-miR-3116	CLIP-seq
MIRT2350711	hsa-miR-3144-5p	CLIP-seq
MIRT2350712	hsa-miR-3151	CLIP-seq
MIRT2350715	hsa-miR-4265	CLIP-seq
MIRT2350716	hsa-miR-4296	CLIP-seq
MIRT2350717	hsa-miR-4322	CLIP-seq
MIRT2350718	hsa-miR-4436b-3p	CLIP-seq
MIRT2350719	hsa-miR-4447	CLIP-seq
MIRT2350720	hsa-miR-4472	CLIP-seq
MIRT2350721	hsa-miR-4514	CLIP-seq
MIRT2350722	hsa-miR-4525	CLIP-seq
MIRT2350723	hsa-miR-4645-5p	CLIP-seq
MIRT2350724	hsa-miR-4652-5p	CLIP-seq
MIRT2350725	hsa-miR-4665-5p	CLIP-seq
MIRT2350726	hsa-miR-4673	CLIP-seq
MIRT2350727	hsa-miR-4688	CLIP-seq
MIRT2350728	hsa-miR-4692	CLIP-seq
MIRT2350729	hsa-miR-4723-5p	CLIP-seq
MIRT2350730	hsa-miR-4763-3p	CLIP-seq
MIRT2350731	hsa-miR-486-3p	CLIP-seq
MIRT2350732	hsa-miR-491-5p	CLIP-seq
MIRT2350733	hsa-miR-625	CLIP-seq
MIRT2644244	hsa-miR-663	CLIP-seq
MIRT2350734	hsa-miR-890	CLIP-seq
MIRT2350735	hsa-miR-940	CLIP-seq
MIRT2350697	hsa-miR-1193	CLIP-seq
MIRT2350698	hsa-miR-1207-5p	CLIP-seq
MIRT2350699	hsa-miR-1254	CLIP-seq
MIRT2350700	hsa-miR-1275	CLIP-seq
MIRT2350701	hsa-miR-1289	CLIP-seq
MIRT2644242	hsa-miR-1908	CLIP-seq
MIRT2350702	hsa-miR-1909	CLIP-seq
MIRT2350703	hsa-miR-24	CLIP-seq
MIRT2350704	hsa-miR-2467-3p	CLIP-seq
MIRT2644243	hsa-miR-2467-5p	CLIP-seq
MIRT2350705	hsa-miR-2861	CLIP-seq
MIRT2350706	hsa-miR-29a	CLIP-seq
MIRT2350707	hsa-miR-29b	CLIP-seq
MIRT2350708	hsa-miR-29c	CLIP-seq
MIRT2350709	hsa-miR-3065-5p	CLIP-seq
MIRT2350710	hsa-miR-3116	CLIP-seq
MIRT2350711	hsa-miR-3144-5p	CLIP-seq
MIRT2350712	hsa-miR-3151	CLIP-seq
MIRT2350715	hsa-miR-4265	CLIP-seq
MIRT2350716	hsa-miR-4296	CLIP-seq
MIRT2350717	hsa-miR-4322	CLIP-seq
MIRT2350718	hsa-miR-4436b-3p	CLIP-seq
MIRT2350719	hsa-miR-4447	CLIP-seq
MIRT2350720	hsa-miR-4472	CLIP-seq
MIRT2350721	hsa-miR-4514	CLIP-seq
MIRT2350722	hsa-miR-4525	CLIP-seq
MIRT2350723	hsa-miR-4645-5p	CLIP-seq
MIRT2350724	hsa-miR-4652-5p	CLIP-seq
MIRT2350725	hsa-miR-4665-5p	CLIP-seq
MIRT2350726	hsa-miR-4673	CLIP-seq
MIRT2350727	hsa-miR-4688	CLIP-seq
MIRT2350728	hsa-miR-4692	CLIP-seq
MIRT2350729	hsa-miR-4723-5p	CLIP-seq
MIRT2350730	hsa-miR-4763-3p	CLIP-seq
MIRT2350731	hsa-miR-486-3p	CLIP-seq
MIRT2350732	hsa-miR-491-5p	CLIP-seq
MIRT2350733	hsa-miR-625	CLIP-seq
MIRT2644244	hsa-miR-663	CLIP-seq
MIRT2350734	hsa-miR-890	CLIP-seq
MIRT2350735	hsa-miR-940	CLIP-seq

Gene ontology (GO) Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0030177	Process	Positive regulation of Wnt signaling pathway	IEA
GO:0042177	Process	Negative regulation of protein catabolic process	IEA
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0061357	Process	Positive regulation of Wnt protein secretion	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145

Other IDs

• MIM: 617363
• HGNC: 31092
• e!Ensembl: ENSG00000006118

Protein

• UniProt ID: Q24JP5
• Protein name: Transmembrane protein 132A (HSPA5-binding protein 1)
• Protein function: May play a role in embryonic and postnatal development of the brain. Increased resistance to cell death induced by serum starvation in cultured cells. Regulates cAMP-induced GFAP gene expression via STAT3 phosphorylation (By similarity). {ECO:00
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15705	TMEM132D_N	48 → 171	Mature oligodendrocyte transmembrane protein, TMEM132D, N-term	Family
  PF15706	TMEM132D_C	816 → 903	Mature oligodendrocyte transmembrane protein, TMEM132D, C-term	Family
  PF16070	TMEM132	407 → 750	Transmembrane protein family 132	Family

• Sequence:

  MCARMAGRTTAAPRGPYGPWLCLLVALALDVVRVDCGQAPLDPVYLPAALELLDAPEHFR
  VQQVGHYPPANSSLSSRSETFLLLQPWPRAQPLLRASYPPFATQQVVPPRVTEPHQRPVP
  WDVRAVSVEAAVTPAEPYARVLFHLKGQDWPPGSGSLPCARLHATHPAGTAHQACRFQPS
  LGACVVELELPSHWFSQASTTRAELAYTLEPAAEGPGGCGSGEENDPGEQALPVGGVELR
  PADPPQYQEVPLDEAVTLRVPDMPVRPGQLFSATLLLRHNFTASLLTLRIKVKKGLHVTA
  ARPAQPTLWTAKLDRFKGSRHHTTLITCHRAGLTEPDSSPLELSEFLWVDFVVENSTGGG
  VAVTRPVTWQLEYPGQAPEAEKDKMVWEILVSERDIRALIPLAKAEELVNTAPLTGVPQH
  VPVRLVTVDGGGALVEVTEHVGCESANTQVLQVSEACDAVFVAGKESRGARGVRVDFWWR
  RLRASLRLTVWAPLLPLRIELTDTTLEQVRGWRVPGPAEGPAEPAAEASDEAERRARGCH
  LQYQRAGVRFLAPFAAHPLDGGRRLTHLLGPDWLLDVSHLVAPHARVLDSRVASLEGGRV
  VVGREPGVTSIEVRSPLSDSILGEQALAVTDDKVSVLELRVQPVMGISLTLSRGTAHPGE
  VTATCWAQSALPAPKQEVALSLWLSFSDHTVAPAELYDRRDLGLSVSAEEPGAILPAEEQ
  GAQLGVVVSGAGAEGLPLHVALHPPEPCRRGRHRVPLASGTAWLGLPPASTPAPALPSSP
  AWSPPATEATMGGKRQVAGSVGGNTGVRGKFERAEEEARKEETEAREEEEEEEEEMVPAP
  QHVTELELGMYALLGVFCVAIFIFLVNGVVFVLRYQRKEPPDSATDPTSPQPHNWVWLGT
  DQEELSRQLDRQSPGPPKGEGSCPCESGGGGEAPTLAPGPPGGTTSSSSTLARKEAGGRR
  KRVEFVTFAPAPPAQSPEEPVGAPAVQSILVAGEEDIRWVCEDMGLKDPEELRNYMERIR
  GSS

• Sequence length: 1023

Pathways

Reactome Pathway

Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)

Post-translational protein phosphorylation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Adrenocortical carcinoma, hereditary	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (19)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Undifferentiated Leukemia	Leukemia	BEFREE	25248926		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37551111	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36303457	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	24373961		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	36303457	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	25511473	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25511473, 29713962		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	30879905		★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	35501731	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	31370002		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	36303457	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30327638		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24583399		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	36303457	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	37033267	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31603456		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	39972314	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	38226611, 39473405	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19861202	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

ENAM 2 shared pathwaysRegulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs), Post-translational protein phosphorylation Related via 2 shared pathways including Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs), Post-translational protein phosphorylation. PRSS23 2 shared pathwaysRegulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs), Post-translational protein phosphorylation Related via 2 shared pathways including Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs), Post-translational protein phosphorylation. CHGB 2 shared pathwaysRegulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs), Post-translational protein phosphorylation Related via 2 shared pathways including Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs), Post-translational protein phosphorylation. AMBN 2 shared pathwaysRegulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs), Post-translational protein phosphorylation Related via 2 shared pathways including Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs), Post-translational protein phosphorylation. AMELX 2 shared pathwaysRegulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs), Post-translational protein phosphorylation Related via 2 shared pathways including Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs), Post-translational protein phosphorylation.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
ENAM	0	[]	2	["Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)","Post-translational protein phosphorylation"]	0	[]
PRSS23	0	[]	2	["Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)","Post-translational protein phosphorylation"]	0	[]
CHGB	0	[]	2	["Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)","Post-translational protein phosphorylation"]	0	[]
AMBN	0	[]	2	["Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)","Post-translational protein phosphorylation"]	0	[]
AMELX	0	[]	2	["Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)","Post-translational protein phosphorylation"]	0	[]

Diseases Linked via Similar Genes

Amelogenesis imperfecta Linked via 3 of 5 related genesENAM, AMBN, AMELX Dentin dysplasia Linked via 3 of 5 related genesENAM, AMBN, AMELX Dentinogenesis imperfecta Linked via 3 of 5 related genesENAM, AMBN, AMELX Coronary artery disease Linked via 2 of 5 related genesENAM, AMBN Alzheimer disease Linked via 1 of 5 related genesPRSS23

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Amelogenesis imperfecta	3	["ENAM","AMBN","AMELX"]
Dentin dysplasia	3	["ENAM","AMBN","AMELX"]
Dentinogenesis imperfecta	3	["ENAM","AMBN","AMELX"]
Coronary artery disease	2	["ENAM","AMBN"]
Alzheimer disease	1	["PRSS23"]