TKTL2 (transketolase like 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 84076
Gene name Transketolase like 2
Gene symbol TKTL2
Synonyms (NCBI Gene)
-
Chromosome 4
Chromosome location 4q32.2
miRNA miRNA information provided by mirtarbase database.
17 Show/Hide all (17)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT019428 hsa-miR-148b-3p Microarray 17612493
MIRT1426044 hsa-miR-1256 CLIP-seq
MIRT1426045 hsa-miR-300 CLIP-seq
MIRT1426046 hsa-miR-3130-3p CLIP-seq
MIRT1426047 hsa-miR-371-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004802 Function Transketolase activity IBA
GO:0004802 Function Transketolase activity IEA
GO:0005737 Component Cytoplasm IDA
GO:0005737 Component Cytoplasm IEA
GO:0016740 Function Transferase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H0I9
Protein name Transketolase-like protein 2 (EC 2.2.1.1)
Protein function Plays an essential role in total transketolase activity and cell proliferation in cancer cells; after transfection with anti-TKTL1 siRNA, total transketolase activity dramatically decreases and proliferation was significantly inhibited in cancer
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00456 Transketolase_N 15 → 286 Transketolase, thiamine diphosphate binding domain Domain
PF02779 Transket_pyr 317 → 482 Transketolase, pyrimidine binding domain Domain
PF02780 Transketolase_C 494 → 616 Transketolase, C-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Overexpressed in hepatoma cancer cells. {ECO:0000269|PubMed:17321041}.
Sequence 
MMANDAKPDVKTVQVLRDTANRLRIHSIRATCASGSGQLTSCCSAAEVVSVLFFHTMKYK
QTDPEHPDNDRFILSRGHAAPILYAAWVEVGDISESDLLNLRKLHSDLERHPTPRLPFVD
VATGSLGQGLGTACGMAYTGKYLDKASYRVFCLMGDGESSEGSVWEAFAFASHYNLDNLV
AVFDVNRLGQSGPAPLEHGADIYQNCCEAFGWNTYLVDGHDVEALCQAFWQASQVKNKPT
AIVAKTFKGRGIPNIEDAENWHGKPVPKERADAIVKLIESQIQTNENLIPKSPVEDSPQI
SITDIKMTSPPAYKVGDKIATQKTYGLALAKLGRANERVIVLSGDTMNSTFSEIFRKEHP
ERFIECIIAEQNMVSVALGCATRGRTIAFAGAFAAFFTRAFDQLRMGAISQANINLIGSH
CGVSTGEDGVSQMALEDLAMFRSIPNCTVFYPSDAISTEHAIYLAANTKGMCFIRTSQPE
TAVIYTPQENFEIGQAKVVRHGVNDKVTVIGAGVTLHEALEAADHLSQQGISVRVIDPFT
IKPLDAATIISSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRG
KTSELLDMFGISTRHIIAAVTLTLMK
Sequence length 626
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Pentose phosphate pathway
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Sort by:
TKTL1 3 shared pathwaysPentose phosphate pathway, Carbon metabolism, Biosynthesis of amino acids Related via 3 shared pathways including Pentose phosphate pathway, Carbon metabolism. RPE 3 shared pathwaysPentose phosphate pathway, Carbon metabolism, Biosynthesis of amino acids Related via 3 shared pathways including Pentose phosphate pathway, Carbon metabolism. TKT 3 shared pathwaysPentose phosphate pathway, Carbon metabolism, Biosynthesis of amino acids Related via 3 shared pathways including Pentose phosphate pathway, Carbon metabolism. RPEL1 3 shared pathwaysPentose phosphate pathway, Carbon metabolism, Biosynthesis of amino acids Related via 3 shared pathways including Pentose phosphate pathway, Carbon metabolism. PGLS 2 shared pathwaysPentose phosphate pathway, Carbon metabolism Related via 2 shared pathways including Pentose phosphate pathway, Carbon metabolism.
Schizophrenia Linked via 1 of 5 related genesTKTL1 Testicular carcinoma Linked via 1 of 5 related genesTKTL1 Testicular germ cell tumor Linked via 1 of 5 related genesTKTL1 Carcinoma Linked via 1 of 5 related genesTKT Gout Linked via 1 of 5 related genesTKT