Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	339488
Gene name	Transcription factor AP-2 epsilon
Gene symbol	TFAP2E
Synonyms (NCBI Gene)	AP-2epsilonAP2E
Chromosome	1
Chromosome location	1p34.3

23 Show/Hide all (23)

miRTarBase ID	miRNA	Experiments
MIRT1419956	hsa-miR-1255a	CLIP-seq
MIRT1419957	hsa-miR-1255b	CLIP-seq
MIRT1419958	hsa-miR-1976	CLIP-seq
MIRT1419959	hsa-miR-2117	CLIP-seq
MIRT1419960	hsa-miR-25	CLIP-seq
MIRT1419961	hsa-miR-32	CLIP-seq
MIRT1419962	hsa-miR-326	CLIP-seq
MIRT1419963	hsa-miR-330-5p	CLIP-seq
MIRT1419964	hsa-miR-363	CLIP-seq
MIRT1419965	hsa-miR-3647-3p	CLIP-seq
MIRT1419966	hsa-miR-367	CLIP-seq
MIRT1419967	hsa-miR-4273	CLIP-seq
MIRT1419968	hsa-miR-4643	CLIP-seq
MIRT1419969	hsa-miR-4715-3p	CLIP-seq
MIRT1419970	hsa-miR-4722-3p	CLIP-seq
MIRT1419971	hsa-miR-4753-3p	CLIP-seq
MIRT1419972	hsa-miR-4782-5p	CLIP-seq
MIRT1419973	hsa-miR-92a	CLIP-seq
MIRT1419974	hsa-miR-92b	CLIP-seq
MIRT2348114	hsa-miR-3065-3p	CLIP-seq
MIRT2348115	hsa-miR-338-3p	CLIP-seq
MIRT2348116	hsa-miR-3667-3p	CLIP-seq
MIRT2348117	hsa-miR-4530	CLIP-seq

16 Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0042802	Function	Identical protein binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
614428	30774	ENSG00000116819

Q6VUC0

Protein name

Transcription factor AP-2-epsilon (AP2-epsilon) (Activating enhancer-binding protein 2-epsilon)

Protein function

Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a la

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03299	TF_AP-2	218 → 412	Transcription factor AP-2	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in skin, primary keratinocytes, immortalized keratinocytes, and HeLa cell line. {ECO:0000269|PubMed:14636996}.

Sequence

MLVHTYSAMERPDGLGAAAGGARLSSLPQAAYGPAPPLCHTPAATAAAEFQPPYFPPPYP
QPPLPYGQAPDAAAAFPHLAGDPYGGLAPLAQPQPPQAAWAAPRAAARAHEEPPGLLAPP
ARALGLDPRRDYATAVPRLLHGLADGAHGLADAPLGLPGLAAAPGLEDLQAMDEPGMSLL
DQSVIKKVPIPSKASSLSALSLAKDSLVGGITNPGEVFCSVPGRLSLLSSTSKYKVTVGE
VQRRLSPPECLNASLLGGVLRRAKSKNGGRCLRERLEKIGLNLPAGRRKAANVTLLTSLV
EGEAVHLARDFGYVCETEFPAKAAAEYLCRQHADPGELHSRKSMLLAAKQICKEFADLMA
QDRSPLGNSRPALILEPGVQSCLTHFSLITHGFGGPAICAALTAFQNYLLESLKGLDKMF
LSSVGSGHGETKASEKDAKHRK

Sequence length

442

Interactions

View interactions

Reactome Pathway
Negative regulation of activity of TFAP2 (AP-2) family transcription factors
Activation of the TFAP2 (AP-2) family of transcription factors

TFAP2E (transcription factor AP-2 epsilon)

Save This Analysis