TEC (tec protein tyrosine kinase)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 7006
• Gene name: Tec protein tyrosine kinase
• Gene symbol: TEC
• Synonyms (NCBI Gene): PSCTK4
• Chromosome: 4
• Chromosome location: 4p12-p11
• Summary: The protein encoded by this gene belongs to the Tec family of non-receptor protein-tyrosine kinases containing a pleckstrin homology domain. Tec family kinases are involved in the intracellular signaling mechanisms of cytokine receptors, lymphocyte surfac

Gene ontology (GO) Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002250	Process	Adaptive immune response	IBA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IDA	10518561
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	TAS	7934162
GO:0005515	Function	Protein binding	IPI	8892607, 10518561, 24728074, 25825872
GO:0005524	Function	ATP binding	IEA
GO:0005543	Function	Phospholipid binding	NAS	10518561
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IDA	9299487, 9652744
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0006468	Process	Protein phosphorylation	TAS	7934162
GO:0007229	Process	Integrin-mediated signaling pathway	IDA	9652744
GO:0008270	Function	Zinc ion binding	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0010543	Process	Regulation of platelet activation	IDA	9299487, 9652744
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	TAS	7934162
GO:0042246	Process	Tissue regeneration	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050852	Process	T cell receptor signaling pathway	IBA
GO:0050853	Process	B cell receptor signaling pathway	IBA
GO:0050853	Process	B cell receptor signaling pathway	IDA	10518561

Other IDs

• MIM: 600583
• HGNC: 11719
• e!Ensembl: ENSG00000135605

Protein

• UniProt ID: P42680
• Protein name: Tyrosine-protein kinase Tec (EC 2.7.10.2)
• Protein function: Non-receptor tyrosine kinase that contributes to signaling from many receptors and participates as a signal transducer in multiple downstream pathways, including regulation of the actin cytoskeleton. Plays a redundant role to ITK in regulation o
• PDB: 2LUL
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00017	SH2	247 → 330	SH2 domain	Domain
  PF00018	SH3_1	185 → 231	SH3 domain	Domain
  PF00169	PH	5 → 111	PH domain	Domain
  PF00779	BTK	119 → 148	BTK motif	Motif
  PF07714	PK_Tyr_Ser-Thr	370 → 619	Protein tyrosine and serine/threonine kinase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in a wide range of cells, including hematopoietic cell lines like myeloid, B-, and T-cell lineages.
• Sequence:

  MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIK
  CVEIVKNDDGVIPCQNKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKY
  HPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIRKALPPAPETKKRRPPPPIPLEEEDNS
  EEIVVAMYDFQAAEGHDLRLERGQEYLILEKNDVHWWRARDKYGNEGYIPSNYVTGKKSN
  NLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHY
  HIKETTTSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSY
  EKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKL
  THPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDVLLSMCQDVCEGMEYL
  ERNSFIHRDLAARNCLVSEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYS
  RFSSKSDVWSFGVLMWEVFTEGRMPFEKYTNYEVVTMVTRGHRLYQPKLASNYVYEVMLR
  CWQEKPEGRPSFEDLLRTIDELVECEETFGR

• Sequence length: 631

TEC (-)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Other IDs Associated diseases Related genes Diseases linked via similar genes

Gene

Entrez ID	100124696
Gene name	-
Gene symbol	TEC
Synonyms (NCBI Gene)	-
Chromosome	19
Chromosome location	19q13.2
Summary	The protein encoded by this gene belongs to the Tec family of non-receptor protein-tyrosine kinases containing a pleckstrin homology domain. Tec family kinases are involved in the intracellular signaling mechanisms of cytokine receptors, lymphocyte surfac

miRNA Show/Hide all (92)

miRTarBase ID	miRNA	Experiments	Reference
MIRT047018	hsa-miR-204-5p	CLASH	23622248
MIRT1417581	hsa-miR-1236	CLIP-seq
MIRT1417582	hsa-miR-1254	CLIP-seq
MIRT1417583	hsa-miR-1255a	CLIP-seq
MIRT1417584	hsa-miR-1255b	CLIP-seq
MIRT1417585	hsa-miR-128	CLIP-seq
MIRT1417586	hsa-miR-2355-5p	CLIP-seq
MIRT1417587	hsa-miR-30a	CLIP-seq
MIRT1417588	hsa-miR-30b	CLIP-seq
MIRT1417589	hsa-miR-30c	CLIP-seq
MIRT1417590	hsa-miR-30d	CLIP-seq
MIRT1417591	hsa-miR-30e	CLIP-seq
MIRT1417592	hsa-miR-3116	CLIP-seq
MIRT1417593	hsa-miR-3136-5p	CLIP-seq
MIRT1417594	hsa-miR-3140-5p	CLIP-seq
MIRT1417595	hsa-miR-324-5p	CLIP-seq
MIRT1417596	hsa-miR-326	CLIP-seq
MIRT1417597	hsa-miR-329	CLIP-seq
MIRT1417598	hsa-miR-330-5p	CLIP-seq
MIRT1417599	hsa-miR-362-3p	CLIP-seq
MIRT1417600	hsa-miR-3926	CLIP-seq
MIRT1417601	hsa-miR-3941	CLIP-seq
MIRT1417602	hsa-miR-4269	CLIP-seq
MIRT1417603	hsa-miR-4283	CLIP-seq
MIRT1417604	hsa-miR-4292	CLIP-seq
MIRT1417605	hsa-miR-4305	CLIP-seq
MIRT1417606	hsa-miR-4439	CLIP-seq
MIRT1417607	hsa-miR-4489	CLIP-seq
MIRT1417608	hsa-miR-4490	CLIP-seq
MIRT1417609	hsa-miR-4513	CLIP-seq
MIRT1417610	hsa-miR-4514	CLIP-seq
MIRT1417611	hsa-miR-4659a-3p	CLIP-seq
MIRT1417612	hsa-miR-4659b-3p	CLIP-seq
MIRT1417613	hsa-miR-4692	CLIP-seq
MIRT1417614	hsa-miR-4742-5p	CLIP-seq
MIRT1417615	hsa-miR-4753-3p	CLIP-seq
MIRT1417616	hsa-miR-4782-5p	CLIP-seq
MIRT1417617	hsa-miR-4790-3p	CLIP-seq
MIRT1417618	hsa-miR-515-3p	CLIP-seq
MIRT1417619	hsa-miR-519e	CLIP-seq
MIRT1417620	hsa-miR-548s	CLIP-seq
MIRT1417621	hsa-miR-550a	CLIP-seq
MIRT1417622	hsa-miR-582-5p	CLIP-seq
MIRT1417623	hsa-miR-593	CLIP-seq
MIRT1417624	hsa-miR-603	CLIP-seq
MIRT1417625	hsa-miR-642b	CLIP-seq
MIRT1417626	hsa-miR-661	CLIP-seq
MIRT1417627	hsa-miR-668	CLIP-seq
MIRT1417628	hsa-miR-942	CLIP-seq
MIRT1417581	hsa-miR-1236	CLIP-seq
MIRT2125391	hsa-miR-3064-5p	CLIP-seq
MIRT2125392	hsa-miR-3605-3p	CLIP-seq
MIRT1417602	hsa-miR-4269	CLIP-seq
MIRT1417610	hsa-miR-4514	CLIP-seq
MIRT1417611	hsa-miR-4659a-3p	CLIP-seq
MIRT1417612	hsa-miR-4659b-3p	CLIP-seq
MIRT1417613	hsa-miR-4692	CLIP-seq
MIRT1417614	hsa-miR-4742-5p	CLIP-seq
MIRT1417615	hsa-miR-4753-3p	CLIP-seq
MIRT2125393	hsa-miR-4768-5p	CLIP-seq
MIRT2125394	hsa-miR-604	CLIP-seq
MIRT2125395	hsa-miR-647	CLIP-seq
MIRT1417628	hsa-miR-942	CLIP-seq
MIRT1417583	hsa-miR-1255a	CLIP-seq
MIRT1417584	hsa-miR-1255b	CLIP-seq
MIRT2347589	hsa-miR-186	CLIP-seq
MIRT2347590	hsa-miR-3120-3p	CLIP-seq
MIRT1417593	hsa-miR-3136-5p	CLIP-seq
MIRT2347591	hsa-miR-3184	CLIP-seq
MIRT1417596	hsa-miR-326	CLIP-seq
MIRT1417598	hsa-miR-330-5p	CLIP-seq
MIRT2347592	hsa-miR-338-5p	CLIP-seq
MIRT2347593	hsa-miR-423-5p	CLIP-seq
MIRT1417606	hsa-miR-4439	CLIP-seq
MIRT1417609	hsa-miR-4513	CLIP-seq
MIRT2347594	hsa-miR-4688	CLIP-seq
MIRT1417616	hsa-miR-4782-5p	CLIP-seq
MIRT1417622	hsa-miR-582-5p	CLIP-seq
MIRT1417623	hsa-miR-593	CLIP-seq
MIRT1417594	hsa-miR-3140-5p	CLIP-seq
MIRT2395637	hsa-miR-3179	CLIP-seq
MIRT2395638	hsa-miR-4747-5p	CLIP-seq
MIRT2395639	hsa-miR-524-3p	CLIP-seq
MIRT2395640	hsa-miR-525-3p	CLIP-seq
MIRT2640558	hsa-miR-3915	CLIP-seq
MIRT2640559	hsa-miR-3928	CLIP-seq
MIRT2640560	hsa-miR-4765	CLIP-seq
MIRT1417618	hsa-miR-515-3p	CLIP-seq
MIRT1417619	hsa-miR-519e	CLIP-seq
MIRT2640561	hsa-miR-544b	CLIP-seq
MIRT1417621	hsa-miR-550a	CLIP-seq
MIRT1417627	hsa-miR-668	CLIP-seq

Other IDs

MIM	HGNC	e!Ensembl
227050	N/A	N/A

Interactions View interactions

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (7)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOSITIS	—	GWAS catalog	36580032	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	38757301	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	24390342, 30423114, 36333501	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	40069456	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (35)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Age related macular degeneration	Age-related macular degeneration	BEFREE	28601519		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	9260752		★☆☆☆☆ Found in Text Mining only
Anemia, Diamond-Blackfan	Anemia	BEFREE	12358933		★☆☆☆☆ Found in Text Mining only
Arthritis Gouty	Gouty arthritis	Pubtator	18512796	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	23867620		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	23867620, 27173733		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19332043, 25480315, 29541388		★☆☆☆☆ Found in Text Mining only
Bruton type agammaglobulinemia	Bruton type agammaglobulinemia	Pubtator	10688822, 9280283, 9446655	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	10359536, 12049818, 22581839		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma Extraskeletal Myxoid	Extraskeletal myxoid chondrosarcoma	Pubtator	12598313, 17302560	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	22524658, 23356224		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	21437271	Associate	★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic Tumor	BEFREE	9344317		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	36736734	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36736734	Associate	★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	19875502		★☆☆☆☆ Found in Text Mining only
Extraskeletal Myxoid Chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	BEFREE	10537274, 11156374, 12049818, 15188455, 22804337		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	31471313		★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	28601519		★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	18512796	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30846469		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	2284097		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19332043, 25480315, 29541388		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28343126		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	9973484		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	7934162		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12049818, 12598313, 29158813		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33213062	Associate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	30735853, 31760337		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	22524658, 23356224		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	24390342		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	24390342		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28607508		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	9344317		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	9973484		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

GRAP2 3 shared pathwaysT cell receptor signaling pathway, Signaling by SCF-KIT, FCERI mediated Ca+2 mobilization Related via 3 shared pathways including T cell receptor signaling pathway, Signaling by SCF-KIT. ITK 2 shared pathwaysT cell receptor signaling pathway, FCERI mediated Ca+2 mobilization Related via 2 shared pathways including T cell receptor signaling pathway, FCERI mediated Ca+2 mobilization. LCP2 3 shared pathwaysOsteoclast differentiation, T cell receptor signaling pathway, FCERI mediated Ca+2 mobilization Related via 3 shared pathways including Osteoclast differentiation, T cell receptor signaling pathway. GAB2 2 shared pathwaysOsteoclast differentiation, Signaling by SCF-KIT Related via 2 shared pathways including Osteoclast differentiation, Signaling by SCF-KIT. VAV1 4 shared pathwaysT cell receptor signaling pathway, Signaling by SCF-KIT, FCERI mediated Ca+2 mobilization, Interleukin-3, Interleukin-5 and GM-CSF signaling Related via 4 shared pathways including T cell receptor signaling pathway, Signaling by SCF-KIT.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
GRAP2	0	[]	3	["T cell receptor signaling pathway","Signaling by SCF-KIT","FCERI mediated Ca+2 mobilization"]	0	[]
ITK	0	[]	2	["T cell receptor signaling pathway","FCERI mediated Ca+2 mobilization"]	0	[]
LCP2	0	[]	3	["Osteoclast differentiation","T cell receptor signaling pathway","FCERI mediated Ca+2 mobilization"]	0	[]
GAB2	0	[]	2	["Osteoclast differentiation","Signaling by SCF-KIT"]	0	[]
VAV1	0	[]	4	["T cell receptor signaling pathway","Signaling by SCF-KIT","FCERI mediated Ca+2 mobilization","Interleukin-3, Interleukin-5 and GM-CSF signaling"]	0	[]

Diseases Linked via Similar Genes

Multiple sclerosis Linked via 2 of 5 related genesGRAP2, ITK Systemic lupus erythematosus Linked via 1 of 5 related genesGRAP2 Asthma Linked via 1 of 5 related genesITK Astrocytoma Linked via 1 of 5 related genesITK Eczema Linked via 1 of 5 related genesITK

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Multiple sclerosis	2	["GRAP2","ITK"]
Systemic lupus erythematosus	1	["GRAP2"]
Asthma	1	["ITK"]
Astrocytoma	1	["ITK"]
Eczema	1	["ITK"]