TAFA5 (TAFA chemokine like family member 5)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 25817
Gene name TAFA chemokine like family member 5
Gene symbol TAFA5
Synonyms (NCBI Gene)
FAM19A5QLLK5208TAFA-5UNQ5208
Chromosome 22
Chromosome location 22q13.32
Summary This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16 Show/Hide all (16)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001664 Function G protein-coupled receptor binding IBA
GO:0001664 Function G protein-coupled receptor binding IPI 29453251
GO:0005125 Function Cytokine activity IEA
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
617499 21592 ENSG00000219438
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7Z5A7
Protein name Chemokine-like protein TAFA-5
Protein function Acts as a chemokine-like protein by regulating cell proliferation and migration through activation of G protein-coupled receptors (GPCRs), such as S1PR2 and FPR2 (By similarity). Stimulates chemotactic migration of macrophages mediated by the MA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12020 TAFA 42 → 131 TAFA family Family
Tissue specificity TISSUE SPECIFICITY: Expressed in the subcutaneous and perirenal adipose tissue (at protein level) (PubMed:29453251). Highly expressed in adipose tissue with moderate expression in the brain and ovary (PubMed:29453251). Isoform 2: Brain-specific (PubMed:15
Sequence 
MAPSPRTGSRQDATALPSMSSTFWAFMILASLLIAYCSQLAAGTCEIVTLDRDSSQPRRT
IARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCT
QPGGRIKTTTVS
Sequence length 132
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
28
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Show/Hide Unknown Diseases (28)
Phenotype Name Clinical Significance Source Reference Evidence Score
ALZHEIMER DISEASE — GWAS catalog 39998322
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER — GWAS catalog 34446935
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER — GWAS catalog 24322204
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CANCER — GWAS catalog 40229280
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA — GWAS catalog 40229280
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (21)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Cholangiocarcinoma Cholangiocarcinoma Pubtator 26060332 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Cognition Disorders Cognition disorder Pubtator 32831973 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 39199384 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Dementia Vascular Vascular dementia Pubtator 32831973 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Diabetes Diabetes BEFREE 31280604
★★★★★
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Diabetes Mellitus BEFREE 31280604
★★★★★
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Type 2 Diabetes mellitus, type 2 Pubtator 31280604 Stimulate
★★★★★
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent Diabetes Mellitus BEFREE 31280604
★★★★★
★☆☆☆☆
Found in Text Mining only
Hyperuricemia Hyperuricemia Pubtator 26722554 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of pancreas Pancreatic cancer GWASDB_DG 22158540
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
KIF26B 4 shared diseasesEndometrial cancer, Endometrial neoplasms, Ocular sarcoidosis, Psychiatric disorders 4 shared evidence sourcesGWAS catalog (Endometrial cancer), GWAS catalog (Endometrial neoplasms), GWAS catalog (Ocular sarcoidosis), GWAS catalog (Psychiatric disorders) Related via 4 shared diseases including Endometrial cancer, Endometrial neoplasms — evidence mostly GWAS catalog. MDN1 3 shared diseasesEndometrial cancer, Endometrial neoplasms, Iga nephropathy 3 shared evidence sourcesGWAS catalog (Endometrial cancer), GWAS catalog (Endometrial neoplasms), GWAS catalog (Iga nephropathy) Related via 3 shared diseases including Endometrial cancer, Endometrial neoplasms — evidence mostly GWAS catalog. H4C8 3 shared diseasesCannabis abuse, Endometrial cancer, Endometrial neoplasms 3 shared evidence sourcesGWAS catalog (Cannabis abuse), GWAS catalog (Endometrial cancer), GWAS catalog (Endometrial neoplasms) Related via 3 shared diseases including Cannabis abuse, Endometrial cancer — evidence mostly GWAS catalog. CASP8AP2 2 shared diseasesEndometrial cancer, Endometrial neoplasms 2 shared evidence sourcesGWAS catalog (Endometrial cancer), GWAS catalog (Endometrial neoplasms) Related via 2 shared diseases including Endometrial cancer, Endometrial neoplasms — evidence mostly GWAS catalog. EVI2A 2 shared diseasesEndometrial cancer, Endometrial neoplasms 2 shared evidence sourcesGWAS catalog (Endometrial cancer), GWAS catalog (Endometrial neoplasms) Related via 2 shared diseases including Endometrial cancer, Endometrial neoplasms — evidence mostly GWAS catalog.
Dental caries Linked via 2 of 5 related genesKIF26B, H4C8 Major depressive disorder Linked via 2 of 5 related genesH4C8, CASP8AP2 Cerebellar ataxia Linked via 1 of 5 related genesKIF26B Diverticular disease Linked via 1 of 5 related genesKIF26B Migraine Linked via 1 of 5 related genesKIF26B