Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	8636
Gene name	SS nuclear autoantigen 1
Gene symbol	SSNA1
Synonyms (NCBI Gene)	N14NA-14NA14
Chromosome	9
Chromosome location	9q34.3

143 Show/Hide all (143)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001330	hsa-miR-1-3p	pSILAC	18668040
MIRT022545	hsa-miR-124-3p	Microarray	18668037
MIRT001330	hsa-miR-1-3p	Proteomics;Other	18668040
MIRT041367	hsa-miR-193b-3p	CLASH	23622248
MIRT2117530	hsa-miR-22	CLIP-seq
MIRT2117531	hsa-miR-3126-5p	CLIP-seq
MIRT2117532	hsa-miR-3185	CLIP-seq
MIRT2117533	hsa-miR-3194-3p	CLIP-seq
MIRT2117534	hsa-miR-3663-3p	CLIP-seq
MIRT2117535	hsa-miR-3921	CLIP-seq
MIRT2117536	hsa-miR-4303	CLIP-seq
MIRT2117537	hsa-miR-4419a	CLIP-seq
MIRT2117538	hsa-miR-4510	CLIP-seq
MIRT2117539	hsa-miR-4653-5p	CLIP-seq
MIRT2117540	hsa-miR-4747-5p	CLIP-seq
MIRT2117541	hsa-miR-4786-5p	CLIP-seq
MIRT2117542	hsa-miR-603	CLIP-seq
MIRT2117543	hsa-miR-769-5p	CLIP-seq
MIRT2339687	hsa-miR-2467-3p	CLIP-seq
MIRT2339688	hsa-miR-3160-3p	CLIP-seq
MIRT2339689	hsa-miR-3661	CLIP-seq
MIRT2339690	hsa-miR-3678-3p	CLIP-seq
MIRT2339691	hsa-miR-4254	CLIP-seq
MIRT2339692	hsa-miR-619	CLIP-seq
MIRT2339693	hsa-miR-631	CLIP-seq
MIRT2633516	hsa-miR-1252	CLIP-seq
MIRT2633517	hsa-miR-1324	CLIP-seq
MIRT2633518	hsa-miR-146b-3p	CLIP-seq
MIRT2633519	hsa-miR-1827	CLIP-seq
MIRT2117530	hsa-miR-22	CLIP-seq
MIRT2633520	hsa-miR-2861	CLIP-seq
MIRT2633521	hsa-miR-296-5p	CLIP-seq
MIRT2633522	hsa-miR-3064-5p	CLIP-seq
MIRT2117531	hsa-miR-3126-5p	CLIP-seq
MIRT2633523	hsa-miR-3150b-3p	CLIP-seq
MIRT2633524	hsa-miR-3157-3p	CLIP-seq
MIRT2339688	hsa-miR-3160-3p	CLIP-seq
MIRT2633525	hsa-miR-3173-5p	CLIP-seq
MIRT2633526	hsa-miR-3184	CLIP-seq
MIRT2117532	hsa-miR-3185	CLIP-seq
MIRT2117533	hsa-miR-3194-3p	CLIP-seq
MIRT2633527	hsa-miR-339-5p	CLIP-seq
MIRT2633528	hsa-miR-3612	CLIP-seq
MIRT2117534	hsa-miR-3663-3p	CLIP-seq
MIRT2633529	hsa-miR-3907	CLIP-seq
MIRT2633530	hsa-miR-3909	CLIP-seq
MIRT2117535	hsa-miR-3921	CLIP-seq
MIRT2633531	hsa-miR-3940-5p	CLIP-seq
MIRT2633532	hsa-miR-423-5p	CLIP-seq
MIRT2633533	hsa-miR-4283	CLIP-seq
MIRT2633534	hsa-miR-4292	CLIP-seq
MIRT2117536	hsa-miR-4303	CLIP-seq
MIRT2117537	hsa-miR-4419a	CLIP-seq
MIRT2633535	hsa-miR-4421	CLIP-seq
MIRT2633536	hsa-miR-4428	CLIP-seq
MIRT2633537	hsa-miR-4464	CLIP-seq
MIRT2633538	hsa-miR-4487	CLIP-seq
MIRT2633539	hsa-miR-4489	CLIP-seq
MIRT2633540	hsa-miR-4507	CLIP-seq
MIRT2117538	hsa-miR-4510	CLIP-seq
MIRT2117539	hsa-miR-4653-5p	CLIP-seq
MIRT2633541	hsa-miR-4656	CLIP-seq
MIRT2633542	hsa-miR-4663	CLIP-seq
MIRT2633543	hsa-miR-4688	CLIP-seq
MIRT2633544	hsa-miR-4689	CLIP-seq
MIRT2633545	hsa-miR-4710	CLIP-seq
MIRT2633546	hsa-miR-4731-5p	CLIP-seq
MIRT2117540	hsa-miR-4747-5p	CLIP-seq
MIRT2633547	hsa-miR-4748	CLIP-seq
MIRT2633548	hsa-miR-4757-5p	CLIP-seq
MIRT2633549	hsa-miR-4761-5p	CLIP-seq
MIRT2633550	hsa-miR-4779	CLIP-seq
MIRT2633551	hsa-miR-4780	CLIP-seq
MIRT2633552	hsa-miR-4784	CLIP-seq
MIRT2117541	hsa-miR-4786-5p	CLIP-seq
MIRT2633553	hsa-miR-544b	CLIP-seq
MIRT2633554	hsa-miR-558	CLIP-seq
MIRT2633555	hsa-miR-589	CLIP-seq
MIRT2117542	hsa-miR-603	CLIP-seq
MIRT2633556	hsa-miR-623	CLIP-seq
MIRT2633557	hsa-miR-624	CLIP-seq
MIRT2633558	hsa-miR-650	CLIP-seq
MIRT2117543	hsa-miR-769-5p	CLIP-seq
MIRT2633559	hsa-miR-874	CLIP-seq
MIRT2633560	hsa-miR-940	CLIP-seq
MIRT2633516	hsa-miR-1252	CLIP-seq
MIRT2633518	hsa-miR-146b-3p	CLIP-seq
MIRT2633519	hsa-miR-1827	CLIP-seq
MIRT2117530	hsa-miR-22	CLIP-seq
MIRT2633520	hsa-miR-2861	CLIP-seq
MIRT2633521	hsa-miR-296-5p	CLIP-seq
MIRT2633522	hsa-miR-3064-5p	CLIP-seq
MIRT2117531	hsa-miR-3126-5p	CLIP-seq
MIRT2633523	hsa-miR-3150b-3p	CLIP-seq
MIRT2633524	hsa-miR-3157-3p	CLIP-seq
MIRT2339688	hsa-miR-3160-3p	CLIP-seq
MIRT2633525	hsa-miR-3173-5p	CLIP-seq
MIRT2633526	hsa-miR-3184	CLIP-seq
MIRT2117532	hsa-miR-3185	CLIP-seq
MIRT2117533	hsa-miR-3194-3p	CLIP-seq
MIRT2633527	hsa-miR-339-5p	CLIP-seq
MIRT2633528	hsa-miR-3612	CLIP-seq
MIRT2117534	hsa-miR-3663-3p	CLIP-seq
MIRT2633530	hsa-miR-3909	CLIP-seq
MIRT2117535	hsa-miR-3921	CLIP-seq
MIRT2633531	hsa-miR-3940-5p	CLIP-seq
MIRT2633532	hsa-miR-423-5p	CLIP-seq
MIRT2633533	hsa-miR-4283	CLIP-seq
MIRT2633534	hsa-miR-4292	CLIP-seq
MIRT2117536	hsa-miR-4303	CLIP-seq
MIRT2117537	hsa-miR-4419a	CLIP-seq
MIRT2633535	hsa-miR-4421	CLIP-seq
MIRT2633536	hsa-miR-4428	CLIP-seq
MIRT2633537	hsa-miR-4464	CLIP-seq
MIRT2633538	hsa-miR-4487	CLIP-seq
MIRT2633539	hsa-miR-4489	CLIP-seq
MIRT2633540	hsa-miR-4507	CLIP-seq
MIRT2117538	hsa-miR-4510	CLIP-seq
MIRT2117539	hsa-miR-4653-5p	CLIP-seq
MIRT2633541	hsa-miR-4656	CLIP-seq
MIRT2633542	hsa-miR-4663	CLIP-seq
MIRT2633543	hsa-miR-4688	CLIP-seq
MIRT2633544	hsa-miR-4689	CLIP-seq
MIRT2633545	hsa-miR-4710	CLIP-seq
MIRT2633546	hsa-miR-4731-5p	CLIP-seq
MIRT2117540	hsa-miR-4747-5p	CLIP-seq
MIRT2633547	hsa-miR-4748	CLIP-seq
MIRT2633548	hsa-miR-4757-5p	CLIP-seq
MIRT2633549	hsa-miR-4761-5p	CLIP-seq
MIRT2633550	hsa-miR-4779	CLIP-seq
MIRT2633551	hsa-miR-4780	CLIP-seq
MIRT2633552	hsa-miR-4784	CLIP-seq
MIRT2117541	hsa-miR-4786-5p	CLIP-seq
MIRT2633553	hsa-miR-544b	CLIP-seq
MIRT2633554	hsa-miR-558	CLIP-seq
MIRT2633555	hsa-miR-589	CLIP-seq
MIRT2117542	hsa-miR-603	CLIP-seq
MIRT2633556	hsa-miR-623	CLIP-seq
MIRT2633557	hsa-miR-624	CLIP-seq
MIRT2633558	hsa-miR-650	CLIP-seq
MIRT2117543	hsa-miR-769-5p	CLIP-seq
MIRT2633559	hsa-miR-874	CLIP-seq
MIRT2633560	hsa-miR-940	CLIP-seq

43 Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IDA	34970964
GO:0000226	Process	Microtubule cytoskeleton organization	ISS
GO:0005515	Function	Protein binding	IPI	25390646, 25416956, 27173435, 28514442, 29892012, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9430706
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	12640030, 21399614, 25390646
GO:0005813	Component	Centrosome	IEA
GO:0005814	Component	Centriole	IDA	25390646
GO:0005814	Component	Centriole	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005929	Component	Cilium	IEA
GO:0005930	Component	Axoneme	IDA	12640030
GO:0007020	Process	Microtubule nucleation	IDA	34970964
GO:0007399	Process	Nervous system development	IEA
GO:0007409	Process	Axonogenesis	IEA
GO:0007409	Process	Axonogenesis	ISS
GO:0008017	Function	Microtubule binding	IDA	34970964
GO:0030424	Component	Axon	IBA
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0030496	Component	Midbody	IDA	25390646
GO:0030496	Component	Midbody	IEA
GO:0031514	Component	Motile cilium	IEA
GO:0036064	Component	Ciliary basal body	IBA
GO:0036064	Component	Ciliary basal body	IDA	12640030
GO:0036064	Component	Ciliary basal body	IEA
GO:0042073	Process	Intraciliary transport	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	21516116, 25416956, 27107012, 32296183
GO:0042995	Component	Cell projection	IEA
GO:0043113	Process	Receptor clustering	IEA
GO:0048675	Process	Axon extension	IBA
GO:0048675	Process	Axon extension	IEA
GO:0048675	Process	Axon extension	IMP	25390646
GO:0048675	Process	Axon extension	ISS
GO:0051301	Process	Cell division	IEA
GO:0051301	Process	Cell division	IMP	25390646
GO:0099512	Component	Supramolecular fiber	IDA	22008182
GO:0140060	Process	Axon arborization	IMP	25390646

MIM	HGNC	e!Ensembl
610882	11321	ENSG00000176101

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	O43805
Protein name	Microtubule nucleation factor SSNA1 (Nuclear autoantigen of 14 kDa) (Sjoegren syndrome nuclear autoantigen 1)
Protein function	Microtubule-binding protein which stabilizes dynamic microtubules by slowing growth and shrinkage at both plus and minus ends and serves as a sensor of microtubule damage, protecting microtubules from the microtubule-severing enzyme SPAST (PubMe
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Widely expressed. {ECO:0000269\|PubMed:9430706}.
Sequence	MTQQGAALQNYNNELVKCIEELCQKREELCRQIQEEEDEKQRLQNEVRQLTEKLARVNEN LARKIASRNEFDRTIAETEAAYLKILESSQTLLSVLKREAGNLTKATAPDQKSSGGRDS
Sequence length	119
Interactions	View interactions

Reactome Pathway
Regulation of PLK1 Activity at G2/M Transition
Loss of Nlp from mitotic centrosomes
Recruitment of mitotic centrosome proteins and complexes
Loss of proteins required for interphase microtubule organization from the centrosome
Recruitment of NuMA to mitotic centrosomes
Anchoring of the basal body to the plasma membrane
AURKA Activation by TPX2

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	37069358	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	22363749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	22363749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	19273306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	22363749		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
SDCCAG8	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]
CEP250	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]
HAUS1	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]
NEDD1	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]
CEP164	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]

SSNA1 (SS nuclear autoantigen 1)

Bookmark This Gene