Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	121441
Gene name	NEDD1 gamma-tubulin ring complex targeting factor
Gene symbol	NEDD1
Synonyms (NCBI Gene)	GCP-WDTUBGCP7
Chromosome	12
Chromosome location	12q23.1

50 Show/Hide all (50)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024542	hsa-miR-215-5p	Microarray	19074876
MIRT026153	hsa-miR-192-5p	Microarray	19074876
MIRT649382	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT649381	hsa-miR-4282	HITS-CLIP	23824327
MIRT649380	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT649379	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT649378	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT649377	hsa-miR-6884-3p	HITS-CLIP	23824327
MIRT649376	hsa-miR-587	HITS-CLIP	23824327
MIRT649382	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT649381	hsa-miR-4282	HITS-CLIP	23824327
MIRT649380	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT649379	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT649378	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT649377	hsa-miR-6884-3p	HITS-CLIP	23824327
MIRT649376	hsa-miR-587	HITS-CLIP	23824327
MIRT1179601	hsa-miR-19a	CLIP-seq
MIRT1179602	hsa-miR-19b	CLIP-seq
MIRT1179603	hsa-miR-2113	CLIP-seq
MIRT1179604	hsa-miR-2681	CLIP-seq
MIRT1179605	hsa-miR-3612	CLIP-seq
MIRT1179606	hsa-miR-380	CLIP-seq
MIRT1179607	hsa-miR-4254	CLIP-seq
MIRT1179608	hsa-miR-4292	CLIP-seq
MIRT1179609	hsa-miR-4308	CLIP-seq
MIRT1179610	hsa-miR-4443	CLIP-seq
MIRT1179611	hsa-miR-4446-5p	CLIP-seq
MIRT1179612	hsa-miR-4698	CLIP-seq
MIRT1179613	hsa-miR-4755-5p	CLIP-seq
MIRT1179614	hsa-miR-548ag	CLIP-seq
MIRT1179615	hsa-miR-548ai	CLIP-seq
MIRT1179616	hsa-miR-570	CLIP-seq
MIRT1179617	hsa-miR-650	CLIP-seq
MIRT1179618	hsa-miR-670	CLIP-seq
MIRT1179619	hsa-miR-1202	CLIP-seq
MIRT1179601	hsa-miR-19a	CLIP-seq
MIRT1179602	hsa-miR-19b	CLIP-seq
MIRT1179620	hsa-miR-200b	CLIP-seq
MIRT1179621	hsa-miR-200c	CLIP-seq
MIRT1179603	hsa-miR-2113	CLIP-seq
MIRT1179622	hsa-miR-3168	CLIP-seq
MIRT1179623	hsa-miR-3668	CLIP-seq
MIRT1179624	hsa-miR-3972	CLIP-seq
MIRT1179625	hsa-miR-429	CLIP-seq
MIRT1179626	hsa-miR-4423-5p	CLIP-seq
MIRT1179612	hsa-miR-4698	CLIP-seq
MIRT1179627	hsa-miR-4703-3p	CLIP-seq
MIRT2391473	hsa-miR-1183	CLIP-seq
MIRT2391474	hsa-miR-3163	CLIP-seq
MIRT2391475	hsa-miR-889	CLIP-seq

23 Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000242	Component	Pericentriolar material	IEA
GO:0000278	Process	Mitotic cell cycle	IBA
GO:0000922	Component	Spindle pole	IBA
GO:0000922	Component	Spindle pole	IEA
GO:0001650	Component	Fibrillar center	IDA
GO:0005515	Function	Protein binding	IPI	19369198, 27137183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	21399614, 27137183
GO:0005813	Component	Centrosome	IEA
GO:0005814	Component	Centriole	IBA
GO:0005814	Component	Centriole	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0007020	Process	Microtubule nucleation	IBA
GO:0036064	Component	Ciliary basal body	IBA
GO:0036064	Component	Ciliary basal body	IEA
GO:0043015	Function	Gamma-tubulin binding	IBA
GO:0045177	Component	Apical part of cell	IEA
GO:0051301	Process	Cell division	IEA

MIM	HGNC	e!Ensembl
600372	7723	ENSG00000139350

Q8NHV4

Protein name

Protein NEDD1 (Neural precursor cell expressed developmentally down-regulated protein 1) (NEDD-1)

Protein function

Required for mitosis progression. Promotes the nucleation of microtubules from the spindle.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00400	WD40	23 → 61	WD domain, G-beta repeat	Repeat

Sequence

MQENLRFASSGDDIKIWDASSMTLVDKFNPHTSPHGISSICWSSNNNFLVTASSSGDKIV
VSSCKCKPVPLLELAEGQKQTCVNLNSTSMYLVSGGLNNTVNIWDLKSKRVHRSLKDHKD
QVTCVTYNWNDCYIASGSLSGEIILHSVTTNLSSTPFGHGSNQSVRHLKYSLFKKSLLGS
VSDNGIVTLWDVNSQSPYHNFDSVHKAPASGICFSPVNELLFVTIGLDKRIILYDTSSKK
LVKTLVADTPLTAVDFMPDGATLAIGSSRGKIYQYDLRMLKSPVKTISAHKTSVQCIAFQ
YSTVLTKSSLNKGCSNKPTTVNKRSVNVNAASGGVQNSGIVREAPATSIATVLPQPMTSA
MGKGTVAVQEKAGLPRSINTDTLSKETDSGKNQDFSSFDDTGKSSLGDMFSPIRDDAVVN
KGSDESIGKGDGFDFLPQLNSVFPPRKNPVTSSTSVLHSSPLNVFMGSPGKEENENRDLT
AESKKIYMGKQESKDSFKQLAKLVTSGAESGNLNTSPSSNQTRNSEKFEKPENEIEAQLI
CEPPINGSSTPNPKIASSVTAGVASSLSEKIADSIGNNRQNAPLTSIQIRFIQNMIQETL
DDFREACHRDIVNLQVEMIKQFHMQLNEMHSLLERYSVNEGLVAEIERLREENKRLRAHF

Sequence length

660

Interactions

View interactions

Reactome Pathway
Regulation of PLK1 Activity at G2/M Transition
Loss of Nlp from mitotic centrosomes
Recruitment of mitotic centrosome proteins and complexes
Loss of proteins required for interphase microtubule organization from the centrosome
Recruitment of NuMA to mitotic centrosomes
Anchoring of the basal body to the plasma membrane
AURKA Activation by TPX2

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CEREBRAL AMYLOID ANGIOPATHY	—	GWAS catalog	34020725	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERNET ADDICTION DISORDER	—	GWAS catalog	36566681	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23106787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	33243845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23106787		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
SDCCAG8	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]
CEP250	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]
HAUS1	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]
CEP164	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]
NINL	[]	7	["Regulation of PLK1 Activity at G2\/M Transition","Loss of Nlp from mitotic centrosomes","Recruitment of mitotic centrosome proteins and complexes","Loss of proteins required for interphase microtubule organization from the centrosome","Recruitment of NuMA to mitotic centrosomes","Anchoring of the basal body to the plasma membrane","AURKA Activation by TPX2"]	[]

NEDD1 (NEDD1 gamma-tubulin ring complex targeting factor)

Bookmark This Gene