SPINT1 (serine peptidase inhibitor, Kunitz type 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 6692
• Gene name: Serine peptidase inhibitor, Kunitz type 1
• Gene symbol: SPINT1
• Synonyms (NCBI Gene): HAI, HAI1, MANSC2
• Chromosome: 15
• Chromosome location: 15q15.1
• Summary: The protein encoded by this gene is a member of the Kunitz family of serine protease inhibitors. The protein is a potent inhibitor specific for HGF activator and is thought to be involved in the regulation of the proteolytic activation of HGF in injured t

miRNA Show/Hide all (226)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1384569	hsa-miR-1185	CLIP-seq
MIRT1384570	hsa-miR-1236	CLIP-seq
MIRT1384571	hsa-miR-138	CLIP-seq
MIRT1384572	hsa-miR-29a	CLIP-seq
MIRT1384573	hsa-miR-29b	CLIP-seq
MIRT1384574	hsa-miR-29c	CLIP-seq
MIRT1384575	hsa-miR-3125	CLIP-seq
MIRT1384576	hsa-miR-3151	CLIP-seq
MIRT1384577	hsa-miR-3663-5p	CLIP-seq
MIRT1384578	hsa-miR-3679-5p	CLIP-seq
MIRT1384579	hsa-miR-384	CLIP-seq
MIRT1384580	hsa-miR-3916	CLIP-seq
MIRT1384581	hsa-miR-3926	CLIP-seq
MIRT1384582	hsa-miR-3976	CLIP-seq
MIRT1384583	hsa-miR-412	CLIP-seq
MIRT1384584	hsa-miR-4283	CLIP-seq
MIRT1384585	hsa-miR-4489	CLIP-seq
MIRT1384586	hsa-miR-4514	CLIP-seq
MIRT1384587	hsa-miR-4650-5p	CLIP-seq
MIRT1384588	hsa-miR-4656	CLIP-seq
MIRT1384589	hsa-miR-4667-3p	CLIP-seq
MIRT1384590	hsa-miR-4692	CLIP-seq
MIRT1384591	hsa-miR-4717-5p	CLIP-seq
MIRT1384592	hsa-miR-4757-5p	CLIP-seq
MIRT1384593	hsa-miR-601	CLIP-seq
MIRT1384594	hsa-miR-645	CLIP-seq
MIRT1384595	hsa-miR-767-5p	CLIP-seq
MIRT1384596	hsa-miR-1233	CLIP-seq
MIRT1384570	hsa-miR-1236	CLIP-seq
MIRT1384597	hsa-miR-1266	CLIP-seq
MIRT1384598	hsa-miR-128	CLIP-seq
MIRT1384599	hsa-miR-1827	CLIP-seq
MIRT1384600	hsa-miR-28-5p	CLIP-seq
MIRT1384601	hsa-miR-296-3p	CLIP-seq
MIRT1384602	hsa-miR-3064-3p	CLIP-seq
MIRT1384603	hsa-miR-31	CLIP-seq
MIRT1384604	hsa-miR-3120-3p	CLIP-seq
MIRT1384605	hsa-miR-3135b	CLIP-seq
MIRT1384606	hsa-miR-3136-3p	CLIP-seq
MIRT1384607	hsa-miR-3139	CLIP-seq
MIRT1384608	hsa-miR-3160-5p	CLIP-seq
MIRT1384609	hsa-miR-3178	CLIP-seq
MIRT1384610	hsa-miR-3184	CLIP-seq
MIRT1384611	hsa-miR-3652	CLIP-seq
MIRT1384577	hsa-miR-3663-5p	CLIP-seq
MIRT1384612	hsa-miR-3664-3p	CLIP-seq
MIRT1384613	hsa-miR-3667-3p	CLIP-seq
MIRT1384614	hsa-miR-3672	CLIP-seq
MIRT1384615	hsa-miR-3921	CLIP-seq
MIRT1384583	hsa-miR-412	CLIP-seq
MIRT1384616	hsa-miR-423-5p	CLIP-seq
MIRT1384617	hsa-miR-4268	CLIP-seq
MIRT1384618	hsa-miR-4292	CLIP-seq
MIRT1384619	hsa-miR-4310	CLIP-seq
MIRT1384620	hsa-miR-4430	CLIP-seq
MIRT1384621	hsa-miR-4436a	CLIP-seq
MIRT1384622	hsa-miR-4448	CLIP-seq
MIRT1384623	hsa-miR-4486	CLIP-seq
MIRT1384624	hsa-miR-4492	CLIP-seq
MIRT1384625	hsa-miR-4498	CLIP-seq
MIRT1384626	hsa-miR-4518	CLIP-seq
MIRT1384627	hsa-miR-4649-3p	CLIP-seq
MIRT1384587	hsa-miR-4650-5p	CLIP-seq
MIRT1384628	hsa-miR-4653-5p	CLIP-seq
MIRT1384589	hsa-miR-4667-3p	CLIP-seq
MIRT1384629	hsa-miR-4672	CLIP-seq
MIRT1384630	hsa-miR-4691-5p	CLIP-seq
MIRT1384631	hsa-miR-4742-5p	CLIP-seq
MIRT1384592	hsa-miR-4757-5p	CLIP-seq
MIRT1384632	hsa-miR-515-5p	CLIP-seq
MIRT1384633	hsa-miR-544	CLIP-seq
MIRT1384634	hsa-miR-593	CLIP-seq
MIRT1384635	hsa-miR-7	CLIP-seq
MIRT1384636	hsa-miR-708	CLIP-seq
MIRT1384637	hsa-miR-762	CLIP-seq
MIRT1384638	hsa-miR-767-3p	CLIP-seq
MIRT1384570	hsa-miR-1236	CLIP-seq
MIRT1384597	hsa-miR-1266	CLIP-seq
MIRT2115101	hsa-miR-1270	CLIP-seq
MIRT1384598	hsa-miR-128	CLIP-seq
MIRT2115102	hsa-miR-1301	CLIP-seq
MIRT2115103	hsa-miR-1323	CLIP-seq
MIRT2115104	hsa-miR-1587	CLIP-seq
MIRT1384599	hsa-miR-1827	CLIP-seq
MIRT2115105	hsa-miR-1912	CLIP-seq
MIRT1384600	hsa-miR-28-5p	CLIP-seq
MIRT2115106	hsa-miR-2861	CLIP-seq
MIRT1384572	hsa-miR-29a	CLIP-seq
MIRT1384573	hsa-miR-29b	CLIP-seq
MIRT1384574	hsa-miR-29c	CLIP-seq
MIRT1384603	hsa-miR-31	CLIP-seq
MIRT1384604	hsa-miR-3120-3p	CLIP-seq
MIRT1384575	hsa-miR-3125	CLIP-seq
MIRT2115107	hsa-miR-3130-5p	CLIP-seq
MIRT1384606	hsa-miR-3136-3p	CLIP-seq
MIRT1384607	hsa-miR-3139	CLIP-seq
MIRT2115108	hsa-miR-3145-5p	CLIP-seq
MIRT2115109	hsa-miR-3153	CLIP-seq
MIRT1384608	hsa-miR-3160-5p	CLIP-seq
MIRT2115110	hsa-miR-3176	CLIP-seq
MIRT1384609	hsa-miR-3178	CLIP-seq
MIRT1384577	hsa-miR-3663-5p	CLIP-seq
MIRT1384612	hsa-miR-3664-3p	CLIP-seq
MIRT1384613	hsa-miR-3667-3p	CLIP-seq
MIRT1384614	hsa-miR-3672	CLIP-seq
MIRT2115111	hsa-miR-3682-5p	CLIP-seq
MIRT2115112	hsa-miR-378g	CLIP-seq
MIRT1384579	hsa-miR-384	CLIP-seq
MIRT1384580	hsa-miR-3916	CLIP-seq
MIRT1384615	hsa-miR-3921	CLIP-seq
MIRT2115113	hsa-miR-3922-3p	CLIP-seq
MIRT2115114	hsa-miR-4261	CLIP-seq
MIRT1384617	hsa-miR-4268	CLIP-seq
MIRT1384618	hsa-miR-4292	CLIP-seq
MIRT2115115	hsa-miR-4434	CLIP-seq
MIRT1384621	hsa-miR-4436a	CLIP-seq
MIRT1384622	hsa-miR-4448	CLIP-seq
MIRT2115116	hsa-miR-4482	CLIP-seq
MIRT1384623	hsa-miR-4486	CLIP-seq
MIRT2115117	hsa-miR-4490	CLIP-seq
MIRT1384624	hsa-miR-4492	CLIP-seq
MIRT2115118	hsa-miR-4496	CLIP-seq
MIRT1384625	hsa-miR-4498	CLIP-seq
MIRT2115119	hsa-miR-4505	CLIP-seq
MIRT1384586	hsa-miR-4514	CLIP-seq
MIRT2115120	hsa-miR-4516	CLIP-seq
MIRT1384626	hsa-miR-4518	CLIP-seq
MIRT2115121	hsa-miR-4531	CLIP-seq
MIRT2115122	hsa-miR-4646-5p	CLIP-seq
MIRT1384627	hsa-miR-4649-3p	CLIP-seq
MIRT1384628	hsa-miR-4653-5p	CLIP-seq
MIRT1384588	hsa-miR-4656	CLIP-seq
MIRT2115123	hsa-miR-4660	CLIP-seq
MIRT2115124	hsa-miR-4668-5p	CLIP-seq
MIRT1384629	hsa-miR-4672	CLIP-seq
MIRT2115125	hsa-miR-4675	CLIP-seq
MIRT2115126	hsa-miR-4679	CLIP-seq
MIRT1384630	hsa-miR-4691-5p	CLIP-seq
MIRT1384590	hsa-miR-4692	CLIP-seq
MIRT2115127	hsa-miR-4736	CLIP-seq
MIRT2115128	hsa-miR-4741	CLIP-seq
MIRT1384631	hsa-miR-4742-5p	CLIP-seq
MIRT2115129	hsa-miR-4774-5p	CLIP-seq
MIRT2115130	hsa-miR-4781-3p	CLIP-seq
MIRT2115131	hsa-miR-5047	CLIP-seq
MIRT1384633	hsa-miR-544	CLIP-seq
MIRT2115132	hsa-miR-548o	CLIP-seq
MIRT2115133	hsa-miR-554	CLIP-seq
MIRT2115134	hsa-miR-556-3p	CLIP-seq
MIRT2115135	hsa-miR-561	CLIP-seq
MIRT2115136	hsa-miR-589	CLIP-seq
MIRT1384634	hsa-miR-593	CLIP-seq
MIRT2115137	hsa-miR-620	CLIP-seq
MIRT2115138	hsa-miR-661	CLIP-seq
MIRT1384635	hsa-miR-7	CLIP-seq
MIRT1384636	hsa-miR-708	CLIP-seq
MIRT1384637	hsa-miR-762	CLIP-seq
MIRT1384638	hsa-miR-767-3p	CLIP-seq
MIRT1384595	hsa-miR-767-5p	CLIP-seq
MIRT2115139	hsa-miR-940	CLIP-seq
MIRT1384570	hsa-miR-1236	CLIP-seq
MIRT2115101	hsa-miR-1270	CLIP-seq
MIRT2337785	hsa-miR-1275	CLIP-seq
MIRT2115102	hsa-miR-1301	CLIP-seq
MIRT2115103	hsa-miR-1323	CLIP-seq
MIRT2115104	hsa-miR-1587	CLIP-seq
MIRT1384600	hsa-miR-28-5p	CLIP-seq
MIRT1384572	hsa-miR-29a	CLIP-seq
MIRT1384573	hsa-miR-29b	CLIP-seq
MIRT1384574	hsa-miR-29c	CLIP-seq
MIRT1384602	hsa-miR-3064-3p	CLIP-seq
MIRT1384604	hsa-miR-3120-3p	CLIP-seq
MIRT1384575	hsa-miR-3125	CLIP-seq
MIRT1384607	hsa-miR-3139	CLIP-seq
MIRT2115108	hsa-miR-3145-5p	CLIP-seq
MIRT1384609	hsa-miR-3178	CLIP-seq
MIRT2337786	hsa-miR-3189-3p	CLIP-seq
MIRT2337787	hsa-miR-3660	CLIP-seq
MIRT1384613	hsa-miR-3667-3p	CLIP-seq
MIRT2115112	hsa-miR-378g	CLIP-seq
MIRT1384579	hsa-miR-384	CLIP-seq
MIRT1384580	hsa-miR-3916	CLIP-seq
MIRT2115114	hsa-miR-4261	CLIP-seq
MIRT2337788	hsa-miR-4286	CLIP-seq
MIRT1384618	hsa-miR-4292	CLIP-seq
MIRT1384619	hsa-miR-4310	CLIP-seq
MIRT2115115	hsa-miR-4434	CLIP-seq
MIRT2337789	hsa-miR-4447	CLIP-seq
MIRT2337790	hsa-miR-4472	CLIP-seq
MIRT1384623	hsa-miR-4486	CLIP-seq
MIRT2337791	hsa-miR-4488	CLIP-seq
MIRT1384624	hsa-miR-4492	CLIP-seq
MIRT2115118	hsa-miR-4496	CLIP-seq
MIRT1384625	hsa-miR-4498	CLIP-seq
MIRT1384586	hsa-miR-4514	CLIP-seq
MIRT2115120	hsa-miR-4516	CLIP-seq
MIRT2337792	hsa-miR-4526	CLIP-seq
MIRT2115121	hsa-miR-4531	CLIP-seq
MIRT2337793	hsa-miR-4651	CLIP-seq
MIRT1384588	hsa-miR-4656	CLIP-seq
MIRT2115123	hsa-miR-4660	CLIP-seq
MIRT2337794	hsa-miR-4665-5p	CLIP-seq
MIRT1384629	hsa-miR-4672	CLIP-seq
MIRT2115125	hsa-miR-4675	CLIP-seq
MIRT2115126	hsa-miR-4679	CLIP-seq
MIRT1384630	hsa-miR-4691-5p	CLIP-seq
MIRT1384590	hsa-miR-4692	CLIP-seq
MIRT2337795	hsa-miR-4697-5p	CLIP-seq
MIRT2115127	hsa-miR-4736	CLIP-seq
MIRT2115128	hsa-miR-4741	CLIP-seq
MIRT2115130	hsa-miR-4781-3p	CLIP-seq
MIRT2337796	hsa-miR-483-3p	CLIP-seq
MIRT2115131	hsa-miR-5047	CLIP-seq
MIRT2115132	hsa-miR-548o	CLIP-seq
MIRT2115133	hsa-miR-554	CLIP-seq
MIRT2115136	hsa-miR-589	CLIP-seq
MIRT2337797	hsa-miR-604	CLIP-seq
MIRT2337798	hsa-miR-608	CLIP-seq
MIRT2115137	hsa-miR-620	CLIP-seq
MIRT1384635	hsa-miR-7	CLIP-seq
MIRT1384636	hsa-miR-708	CLIP-seq
MIRT1384637	hsa-miR-762	CLIP-seq
MIRT1384595	hsa-miR-767-5p	CLIP-seq
MIRT2115139	hsa-miR-940	CLIP-seq
MIRT1384604	hsa-miR-3120-3p	CLIP-seq
MIRT1384629	hsa-miR-4672	CLIP-seq

Gene ontology (GO) Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001843	Process	Neural tube closure	IEA
GO:0001892	Process	Embryonic placenta development	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IBA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	TAS	9045658
GO:0005515	Function	Protein binding	IPI	15713485, 32296183, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	9045658
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0008544	Process	Epidermis development	IBA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9045658
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0045687	Process	Positive regulation of glial cell differentiation	IEA
GO:0060429	Process	Epithelium development	IBA
GO:0060670	Process	Branching involved in labyrinthine layer morphogenesis	IEA
GO:0060674	Process	Placenta blood vessel development	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071773	Process	Cellular response to BMP stimulus	IEA
GO:2000178	Process	Negative regulation of neural precursor cell proliferation	IEA

Other IDs

• MIM: 605123
• HGNC: 11246
• e!Ensembl: ENSG00000166145

Protein

• UniProt ID: O43278
• Protein name: Kunitz-type protease inhibitor 1 (Hepatocyte growth factor activator inhibitor type 1) (HAI-1)
• Protein function: Inhibitor of HGFAC (PubMed:9045658). Inhibits serine protease activity of ST14/matriptase in vitro (PubMed:28710277). Inhibits serine protease activity of TMPRSS13, via the BPTI/Kunitz inhibitor 1 domain (PubMed:20977675). {ECO:0000269|PubMed:20
• PDB: 1YC0 , 2MSX , 4ISL , 4ISN , 4ISO , 5EZD , 5H7V
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00014	Kunitz_BPTI	390 → 442	Kunitz/Bovine pancreatic trypsin inhibitor domain	Domain
  PF00014	Kunitz_BPTI	249 → 301	Kunitz/Bovine pancreatic trypsin inhibitor domain	Domain
  PF00057	Ldl_recept_a	333 → 369	Low-density lipoprotein receptor domain class A	Repeat
  PF07502	MANEC	48 → 139	MANEC domain	Domain

• Sequence:

  MAPARTMARARLAPAGIPAVALWLLCTLGLQGTQAGPPPAPPGLPAGADCLNSFTAGVPG
  FVLDTNASVSNGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLIN
  CLYEQNFVCKFAPREGFINYLTREVYRSYRQLRTQGFGGSGIPKAWAGIDLKVQPQEPLV
  LKDVENTDWRLLRGDTDVRVERKDPNQVELWGLKEGTYLFQLTVTSSDHPEDTANVTVTV
  LSTKQTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLREEECILAC
  RGVQGGPLRGSSGAQATFPQGPSMERRHPVCSGTCQPTQFRCSNGCCIDSFLECDDTPNC
  PDASDEAACEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHCARFT
  YGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPSTGSVEMAVAVFLVICIVVVV
  AILGYCFFKNQRKDFHGHHHHPPPTPASSTVSTTEDTEHLVYNHTTRPL

• Sequence length: 529

Pathways

KEGG Pathway	Reactome Pathway
Transcriptional misregulation in cancer	MET Receptor Activation
Prostate cancer	Signaling by MST1

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Lung cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (88)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	15471558		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	15471558		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	27992572	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	17935617		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29095880		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	24659667		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	21898507		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11562767, 16557597, 20716618		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11290548, 34381422	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11085539		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	11290548	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31558918	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	29202869	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33425212, 39175011	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19148468, 27356668		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	17935617	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	15994391		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	11708800, 17897910		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	27992572	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11085539, 15471558, 23979832, 30022840, 31519199		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16820046		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16820046	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35068341	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	38212428	Inhibit	★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	21898507		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14713848		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	31519199		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30589402		★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	29532159		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	20715109		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	24935567		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	20664929		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	15834927, 25952099		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	29532159		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	LHGDN	16273651		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	12560427		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16051034, 17949349		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	16051034, 17949349		★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	40649881	Associate	★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	15834927		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	27612426		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30589402		★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	20664929		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma of uterus	Leiomyosarcoma Of Uterus	BEFREE	20664929		★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	20664929		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11708800, 31558918		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	11708800, 17897910		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	33884041	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	33884041	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	12560427		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34185790	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11290548, 11562767, 16557597, 20716618		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	20715109		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19148468, 27356668		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17516570, 24659667		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	10762618, 28618968		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11562767, 12815039, 15471558, 16557597, 19223533, 23591195, 25310042, 25925948, 29046355, 29431273, 29532159, 31024856, 31519199		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20716618, 31436357		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31519199		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	14734471, 20664929, 22447520, 27612426, 31417276, 31436357		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25925948		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19148468, 27356668		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27356668	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29532159		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	16941151		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17516570, 24659667		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	24659667	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15972969	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16467405, 24659667	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17786295		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19448157		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14713848		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	12560427		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	21123732	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	29545930, 31519199		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31417276		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	11508667, 15834927, 24935567		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	10762618, 28618968		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16273651	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28618968	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer, follicular	Thyroid cancer	BEFREE	29532159		★☆☆☆☆ Found in Text Mining only
Timothy syndrome	Timothy Syndrome	BEFREE	12560427		★☆☆☆☆ Found in Text Mining only
Tricuspid Valve Stenosis	Tricuspid Valve Stenosis	BEFREE	12560427		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	12560427		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23591195	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35127296	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	29202869	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	20664929		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

ERG 2 shared pathwaysTranscriptional misregulation in cancer, Prostate cancer Related via 2 shared pathways including Transcriptional misregulation in cancer, Prostate cancer. ETV5 2 shared pathwaysTranscriptional misregulation in cancer, Prostate cancer Related via 2 shared pathways including Transcriptional misregulation in cancer, Prostate cancer. SPINT2 2 shared pathwaysMET Receptor Activation, Signaling by MST1 Related via 2 shared pathways including MET Receptor Activation, Signaling by MST1. ZEB1 2 shared pathwaysTranscriptional misregulation in cancer, Prostate cancer Related via 2 shared pathways including Transcriptional misregulation in cancer, Prostate cancer. HPN 2 shared pathwaysMET Receptor Activation, Signaling by MST1 Related via 2 shared pathways including MET Receptor Activation, Signaling by MST1.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
ERG	0	[]	2	["Transcriptional misregulation in cancer","Prostate cancer"]	0	[]
ETV5	0	[]	2	["Transcriptional misregulation in cancer","Prostate cancer"]	0	[]
SPINT2	0	[]	2	["MET Receptor Activation","Signaling by MST1"]	0	[]
ZEB1	0	[]	2	["Transcriptional misregulation in cancer","Prostate cancer"]	0	[]
HPN	0	[]	2	["MET Receptor Activation","Signaling by MST1"]	0	[]

Diseases Linked via Similar Genes

Prostatic neoplasms Linked via 3 of 5 related genesERG, ETV5, HPN Coronary artery disease Linked via 2 of 5 related genesERG, ZEB1 Major depressive disorder Linked via 2 of 5 related genesERG, ETV5 Osteoarthritis Linked via 2 of 5 related genesERG, ETV5 Ovarian cancer Linked via 2 of 5 related genesERG, SPINT2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Prostatic neoplasms	3	["ERG","ETV5","HPN"]
Coronary artery disease	2	["ERG","ZEB1"]
Major depressive disorder	2	["ERG","ETV5"]
Osteoarthritis	2	["ERG","ETV5"]
Ovarian cancer	2	["ERG","SPINT2"]