Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	6637
Gene name	Small nuclear ribonucleoprotein polypeptide G
Gene symbol	SNRPG
Synonyms (NCBI Gene)	SMGSm-G
Chromosome	2
Chromosome location	2p13.3
Summary	The protein encoded by this gene is a component of the U1, U2, U4, and U5 small nuclear ribonucleoprotein complexes, precursors of the spliceosome. The encoded protein may also be a part of the U7 small nuclear ribonucleoprotein complex, which participate

19 Show/Hide all (19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044593	hsa-miR-320a	CLASH	23622248
MIRT1376273	hsa-miR-185	CLIP-seq
MIRT1376274	hsa-miR-4306	CLIP-seq
MIRT1376275	hsa-miR-4644	CLIP-seq
MIRT1376276	hsa-miR-4735-5p	CLIP-seq
MIRT1376277	hsa-miR-4768-5p	CLIP-seq
MIRT1376278	hsa-miR-4775	CLIP-seq
MIRT1376279	hsa-miR-4802-5p	CLIP-seq
MIRT1376280	hsa-miR-499-3p	CLIP-seq
MIRT1376281	hsa-miR-499a-3p	CLIP-seq
MIRT1376282	hsa-miR-590-3p	CLIP-seq
MIRT1376283	hsa-miR-629	CLIP-seq
MIRT1376273	hsa-miR-185	CLIP-seq
MIRT1376274	hsa-miR-4306	CLIP-seq
MIRT1376275	hsa-miR-4644	CLIP-seq
MIRT1376277	hsa-miR-4768-5p	CLIP-seq
MIRT1376279	hsa-miR-4802-5p	CLIP-seq
MIRT1376283	hsa-miR-629	CLIP-seq
MIRT1376277	hsa-miR-4768-5p	CLIP-seq

60 Show/Hide all (60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000245	Process	Spliceosomal complex assembly	NAS	7744013
GO:0000387	Process	Spliceosomal snRNP assembly	IDA	18984161
GO:0000398	Process	MRNA splicing, via spliceosome	IBA
GO:0000398	Process	MRNA splicing, via spliceosome	IC	11991638
GO:0000398	Process	MRNA splicing, via spliceosome	IDA	28076346, 32494006, 36797247
GO:0000398	Process	MRNA splicing, via spliceosome	IEA
GO:0000398	Process	MRNA splicing, via spliceosome	NAS	15564372, 30975767, 31744343, 33677607
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	9417867, 12165861, 14603251, 15939020, 16189514, 17332742, 18984161, 22365833, 25416956, 30021884, 31799625, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IDA	28076346
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	21113136, 30975767, 31744343
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005681	Component	Spliceosomal complex	IEA
GO:0005681	Component	Spliceosomal complex	IPI	30975767, 33677607
GO:0005681	Component	Spliceosomal complex	NAS	31744343
GO:0005681	Component	Spliceosomal complex	TAS	7744013
GO:0005682	Component	U5 snRNP	IBA
GO:0005682	Component	U5 snRNP	NAS	15564372
GO:0005683	Component	U7 snRNP	IDA	11574479
GO:0005684	Component	U2-type spliceosomal complex	IDA	32494006, 36797247
GO:0005685	Component	U1 snRNP	IBA
GO:0005685	Component	U1 snRNP	IDA	21113136, 25555158
GO:0005685	Component	U1 snRNP	IPI	33677607
GO:0005685	Component	U1 snRNP	NAS	15564372
GO:0005686	Component	U2 snRNP	IBA
GO:0005686	Component	U2 snRNP	NAS	15564372, 31744343
GO:0005687	Component	U4 snRNP	IBA
GO:0005687	Component	U4 snRNP	IDA	21516107
GO:0005687	Component	U4 snRNP	NAS	15564372
GO:0005689	Component	U12-type spliceosomal complex	IBA
GO:0005689	Component	U12-type spliceosomal complex	IDA	15146077
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	18984161
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006397	Process	MRNA processing	IEA
GO:0008380	Process	RNA splicing	IEA
GO:0008380	Process	RNA splicing	TAS	7744013
GO:0030532	Component	Small nuclear ribonucleoprotein complex	IEA
GO:0030532	Component	Small nuclear ribonucleoprotein complex	NAS	7744013
GO:0034709	Component	Methylosome	IDA	18984161
GO:0034719	Component	SMN-Sm protein complex	IBA
GO:0034719	Component	SMN-Sm protein complex	IDA	18984161
GO:0036261	Process	7-methylguanosine cap hypermethylation	NAS	15564372
GO:0043186	Component	P granule	IBA
GO:0046540	Component	U4/U6 x U5 tri-snRNP complex	IDA	26912367
GO:0046540	Component	U4/U6 x U5 tri-snRNP complex	IPI	30975767
GO:0071004	Component	U2-type prespliceosome	IBA
GO:0071005	Component	U2-type precatalytic spliceosome	IDA	28781166
GO:0071007	Component	U2-type catalytic step 2 spliceosome	IDA	28076346
GO:0071011	Component	Precatalytic spliceosome	IBA
GO:0071013	Component	Catalytic step 2 spliceosome	IBA
GO:0071013	Component	Catalytic step 2 spliceosome	IDA	11991638
GO:0097526	Component	Spliceosomal tri-snRNP complex	IBA
GO:1903241	Process	U2-type prespliceosome assembly	NAS	31744343
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
603542	11163	ENSG00000143977

P62308

Protein name

Small nuclear ribonucleoprotein G (snRNP-G) (Sm protein G) (Sm-G) (SmG)

Protein function

Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome (PubMed:11991638, PubMed:18984161, PubMed:19325628, PubMed:23333303, Pu

PDB

3CW1 , 3JCR , 3PGW , 4F7U , 4PJO , 4V98 , 4WZJ , 5MQF , 5O9Z , 5XJC , 5XJL , 5XJQ , 5XJR , 5XJT , 5XJU , 5YZG , 5Z56 , 5Z57 , 5Z58 , 6AH0 , 6AHD , 6FF7 , 6ICZ , 6ID0 , 6ID1 , 6QDV , 6QW6 , 6QX9 , 6V4X , 6Y53 , 6Y5Q , 7A5P , 7ABG , 7ABI , 7B0Y , 7DVQ , 7EVO , 7QTT , 7VPX , 7W59 , 7W5A , 7W5B , 8C6J , 8CH6 , 8H6E , 8H6J , 8H6K , 8H6L , 8HK1 , 8I0P , 8I0R

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01423	LSM	7 → 72	LSM domain	Domain

Sequence

MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMV
VIRGNSIIMLEALERV

Sequence length

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Spliceosome	SLBP independent Processing of Histone Pre-mRNAs
	snRNP Assembly
	mRNA Splicing - Major Pathway
	mRNA Splicing - Minor Pathway
	RNA Polymerase II Transcription Termination
	SLBP Dependent Processing of Replication-Dependent Histone Pre-mRNAs

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
SNRPE	[]	7	["Spliceosome","mRNA Splicing - Major Pathway","snRNP Assembly","mRNA Splicing - Minor Pathway","RNA Polymerase II Transcription Termination","SLBP independent Processing of Histone Pre-mRNAs","SLBP Dependent Processing of Replication-Dependent Histone Pre-mRNAs"]	[]
SNRPF	[]	7	["Spliceosome","mRNA Splicing - Major Pathway","snRNP Assembly","mRNA Splicing - Minor Pathway","RNA Polymerase II Transcription Termination","SLBP independent Processing of Histone Pre-mRNAs","SLBP Dependent Processing of Replication-Dependent Histone Pre-mRNAs"]	[]
SNRPB	[]	7	["Spliceosome","mRNA Splicing - Major Pathway","snRNP Assembly","mRNA Splicing - Minor Pathway","RNA Polymerase II Transcription Termination","SLBP independent Processing of Histone Pre-mRNAs","SLBP Dependent Processing of Replication-Dependent Histone Pre-mRNAs"]	[]
SNRPD3	[]	7	["Spliceosome","mRNA Splicing - Major Pathway","snRNP Assembly","mRNA Splicing - Minor Pathway","RNA Polymerase II Transcription Termination","SLBP independent Processing of Histone Pre-mRNAs","SLBP Dependent Processing of Replication-Dependent Histone Pre-mRNAs"]	[]
SNRPD2	[]	4	["Spliceosome","mRNA Splicing - Major Pathway","snRNP Assembly","mRNA Splicing - Minor Pathway"]	[]

SNRPG (small nuclear ribonucleoprotein polypeptide G)

Bookmark This Gene