SLC6A15 (solute carrier family 6 member 15)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 55117
• Gene name: Solute carrier family 6 member 15
• Gene symbol: SLC6A15
• Synonyms (NCBI Gene): NTT73, SBAT1, V7-3, hv7-3
• Chromosome: 12
• Chromosome location: 12q21.31
• Summary: This gene encodes a member of the solute carrier family 6 protein family which transports neutral amino acids. The encoded protein is thought to play a role in neuronal amino acid transport (PMID: 16185194) and may be associated with major depression (PMI

miRNA Show/Hide all (216)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050428	hsa-miR-23a-3p	CLASH	23622248
MIRT046356	hsa-miR-23b-3p	CLASH	23622248
MIRT042665	hsa-miR-196b-5p	CLASH	23622248
MIRT1366058	hsa-miR-101	CLIP-seq
MIRT1366059	hsa-miR-1244	CLIP-seq
MIRT1366060	hsa-miR-128	CLIP-seq
MIRT1366061	hsa-miR-1301	CLIP-seq
MIRT1366062	hsa-miR-186	CLIP-seq
MIRT1366063	hsa-miR-27a	CLIP-seq
MIRT1366064	hsa-miR-27b	CLIP-seq
MIRT1366065	hsa-miR-3133	CLIP-seq
MIRT1366066	hsa-miR-3143	CLIP-seq
MIRT1366067	hsa-miR-3168	CLIP-seq
MIRT1366068	hsa-miR-338-5p	CLIP-seq
MIRT1366069	hsa-miR-3617	CLIP-seq
MIRT1366070	hsa-miR-369-3p	CLIP-seq
MIRT1366071	hsa-miR-374a	CLIP-seq
MIRT1366072	hsa-miR-374b	CLIP-seq
MIRT1366073	hsa-miR-374c	CLIP-seq
MIRT1366074	hsa-miR-4317	CLIP-seq
MIRT1366075	hsa-miR-4437	CLIP-seq
MIRT1366076	hsa-miR-4639-5p	CLIP-seq
MIRT1366077	hsa-miR-4660	CLIP-seq
MIRT1366078	hsa-miR-4666-3p	CLIP-seq
MIRT1366079	hsa-miR-4668-3p	CLIP-seq
MIRT1366080	hsa-miR-4674	CLIP-seq
MIRT1366081	hsa-miR-4684-3p	CLIP-seq
MIRT1366082	hsa-miR-4698	CLIP-seq
MIRT1366083	hsa-miR-491-3p	CLIP-seq
MIRT1366084	hsa-miR-5047	CLIP-seq
MIRT1366085	hsa-miR-543	CLIP-seq
MIRT1366086	hsa-miR-548c-3p	CLIP-seq
MIRT1366087	hsa-miR-548n	CLIP-seq
MIRT1366088	hsa-miR-607	CLIP-seq
MIRT1366089	hsa-miR-641	CLIP-seq
MIRT1366090	hsa-miR-655	CLIP-seq
MIRT1366091	hsa-miR-203	CLIP-seq
MIRT1366092	hsa-miR-302a	CLIP-seq
MIRT1366093	hsa-miR-302b	CLIP-seq
MIRT1366094	hsa-miR-302c	CLIP-seq
MIRT1366095	hsa-miR-302d	CLIP-seq
MIRT1366096	hsa-miR-302e	CLIP-seq
MIRT1366097	hsa-miR-302f	CLIP-seq
MIRT1366098	hsa-miR-3129-3p	CLIP-seq
MIRT1366099	hsa-miR-3136-5p	CLIP-seq
MIRT1366100	hsa-miR-372	CLIP-seq
MIRT1366101	hsa-miR-373	CLIP-seq
MIRT1366102	hsa-miR-4328	CLIP-seq
MIRT1366103	hsa-miR-4439	CLIP-seq
MIRT1366104	hsa-miR-4513	CLIP-seq
MIRT1366105	hsa-miR-4659a-3p	CLIP-seq
MIRT1366106	hsa-miR-4659b-3p	CLIP-seq
MIRT1366107	hsa-miR-4774-3p	CLIP-seq
MIRT1366108	hsa-miR-512-3p	CLIP-seq
MIRT1366109	hsa-miR-519a	CLIP-seq
MIRT1366110	hsa-miR-519b-3p	CLIP-seq
MIRT1366111	hsa-miR-519c-3p	CLIP-seq
MIRT1366112	hsa-miR-520a-3p	CLIP-seq
MIRT1366113	hsa-miR-520b	CLIP-seq
MIRT1366114	hsa-miR-520c-3p	CLIP-seq
MIRT1366115	hsa-miR-520d-3p	CLIP-seq
MIRT1366116	hsa-miR-520e	CLIP-seq
MIRT1366086	hsa-miR-548c-3p	CLIP-seq
MIRT1366117	hsa-miR-628-5p	CLIP-seq
MIRT1366097	hsa-miR-302f	CLIP-seq
MIRT2332283	hsa-miR-30a	CLIP-seq
MIRT2332284	hsa-miR-30b	CLIP-seq
MIRT2332285	hsa-miR-30c	CLIP-seq
MIRT2332286	hsa-miR-30d	CLIP-seq
MIRT2332287	hsa-miR-30e	CLIP-seq
MIRT2332288	hsa-miR-3123	CLIP-seq
MIRT1366098	hsa-miR-3129-3p	CLIP-seq
MIRT2332289	hsa-miR-3130-3p	CLIP-seq
MIRT1366102	hsa-miR-4328	CLIP-seq
MIRT2332290	hsa-miR-4495	CLIP-seq
MIRT2332291	hsa-miR-450b-5p	CLIP-seq
MIRT1366105	hsa-miR-4659a-3p	CLIP-seq
MIRT1366106	hsa-miR-4659b-3p	CLIP-seq
MIRT2332292	hsa-miR-4719	CLIP-seq
MIRT2332293	hsa-miR-4793-3p	CLIP-seq
MIRT2332294	hsa-miR-500a	CLIP-seq
MIRT2332295	hsa-miR-501-5p	CLIP-seq
MIRT2332296	hsa-miR-507	CLIP-seq
MIRT2332297	hsa-miR-544	CLIP-seq
MIRT2332298	hsa-miR-557	CLIP-seq
MIRT2459839	hsa-miR-376a	CLIP-seq
MIRT2459840	hsa-miR-376b	CLIP-seq
MIRT2459841	hsa-miR-4663	CLIP-seq
MIRT2626717	hsa-let-7a	CLIP-seq
MIRT2626718	hsa-let-7b	CLIP-seq
MIRT2626719	hsa-let-7c	CLIP-seq
MIRT2626720	hsa-let-7d	CLIP-seq
MIRT2626721	hsa-let-7e	CLIP-seq
MIRT2626722	hsa-let-7f	CLIP-seq
MIRT2626723	hsa-let-7g	CLIP-seq
MIRT2626724	hsa-let-7i	CLIP-seq
MIRT2626725	hsa-miR-10a	CLIP-seq
MIRT2626726	hsa-miR-10b	CLIP-seq
MIRT2626727	hsa-miR-1206	CLIP-seq
MIRT2626728	hsa-miR-1258	CLIP-seq
MIRT2626729	hsa-miR-1296	CLIP-seq
MIRT2626730	hsa-miR-137	CLIP-seq
MIRT2626731	hsa-miR-155	CLIP-seq
MIRT2626732	hsa-miR-1912	CLIP-seq
MIRT2626733	hsa-miR-202	CLIP-seq
MIRT2626734	hsa-miR-216a	CLIP-seq
MIRT2626735	hsa-miR-3117-5p	CLIP-seq
MIRT2626736	hsa-miR-3157-3p	CLIP-seq
MIRT2626737	hsa-miR-3159	CLIP-seq
MIRT2626738	hsa-miR-3161	CLIP-seq
MIRT2626739	hsa-miR-340	CLIP-seq
MIRT2626740	hsa-miR-3622a-3p	CLIP-seq
MIRT2626741	hsa-miR-3622b-3p	CLIP-seq
MIRT2626742	hsa-miR-3646	CLIP-seq
MIRT2626743	hsa-miR-3662	CLIP-seq
MIRT2626744	hsa-miR-371-3p	CLIP-seq
MIRT2626745	hsa-miR-371b-3p	CLIP-seq
MIRT2626746	hsa-miR-377	CLIP-seq
MIRT2626747	hsa-miR-3941	CLIP-seq
MIRT2626748	hsa-miR-4264	CLIP-seq
MIRT2626749	hsa-miR-4279	CLIP-seq
MIRT2626750	hsa-miR-4290	CLIP-seq
MIRT2626751	hsa-miR-4297	CLIP-seq
MIRT2626752	hsa-miR-4324	CLIP-seq
MIRT2626753	hsa-miR-4427	CLIP-seq
MIRT2626754	hsa-miR-4458	CLIP-seq
MIRT2626755	hsa-miR-4470	CLIP-seq
MIRT2626756	hsa-miR-4473	CLIP-seq
MIRT2626757	hsa-miR-4493	CLIP-seq
MIRT2626758	hsa-miR-4500	CLIP-seq
MIRT2626759	hsa-miR-4512	CLIP-seq
MIRT2626760	hsa-miR-452	CLIP-seq
MIRT2626761	hsa-miR-4639-3p	CLIP-seq
MIRT2626762	hsa-miR-466	CLIP-seq
MIRT2626763	hsa-miR-4670-3p	CLIP-seq
MIRT2626764	hsa-miR-4671-3p	CLIP-seq
MIRT2626765	hsa-miR-4672	CLIP-seq
MIRT2626766	hsa-miR-4676-3p	CLIP-seq
MIRT2626767	hsa-miR-4680-3p	CLIP-seq
MIRT2626768	hsa-miR-4691-3p	CLIP-seq
MIRT2626769	hsa-miR-4704-3p	CLIP-seq
MIRT2626770	hsa-miR-4717-3p	CLIP-seq
MIRT2626771	hsa-miR-4731-3p	CLIP-seq
MIRT2626772	hsa-miR-4738-3p	CLIP-seq
MIRT2626773	hsa-miR-4786-3p	CLIP-seq
MIRT2626774	hsa-miR-4789-3p	CLIP-seq
MIRT2626775	hsa-miR-4797-3p	CLIP-seq
MIRT2626776	hsa-miR-4801	CLIP-seq
MIRT2626777	hsa-miR-505	CLIP-seq
MIRT2626778	hsa-miR-5096	CLIP-seq
MIRT2626779	hsa-miR-513a-3p	CLIP-seq
MIRT2626780	hsa-miR-515-3p	CLIP-seq
MIRT2626781	hsa-miR-519e	CLIP-seq
MIRT2626782	hsa-miR-548aa	CLIP-seq
MIRT1366086	hsa-miR-548c-3p	CLIP-seq
MIRT2626783	hsa-miR-579	CLIP-seq
MIRT2626784	hsa-miR-590-3p	CLIP-seq
MIRT2626785	hsa-miR-651	CLIP-seq
MIRT2626786	hsa-miR-874	CLIP-seq
MIRT2626787	hsa-miR-944	CLIP-seq
MIRT2626788	hsa-miR-98	CLIP-seq
MIRT2626725	hsa-miR-10a	CLIP-seq
MIRT2626726	hsa-miR-10b	CLIP-seq
MIRT2626727	hsa-miR-1206	CLIP-seq
MIRT2626728	hsa-miR-1258	CLIP-seq
MIRT2626729	hsa-miR-1296	CLIP-seq
MIRT2626731	hsa-miR-155	CLIP-seq
MIRT2626734	hsa-miR-216a	CLIP-seq
MIRT2626735	hsa-miR-3117-5p	CLIP-seq
MIRT2626736	hsa-miR-3157-3p	CLIP-seq
MIRT2626737	hsa-miR-3159	CLIP-seq
MIRT2626738	hsa-miR-3161	CLIP-seq
MIRT2626739	hsa-miR-340	CLIP-seq
MIRT2626740	hsa-miR-3622a-3p	CLIP-seq
MIRT2626741	hsa-miR-3622b-3p	CLIP-seq
MIRT2626742	hsa-miR-3646	CLIP-seq
MIRT2626743	hsa-miR-3662	CLIP-seq
MIRT2626744	hsa-miR-371-3p	CLIP-seq
MIRT2626745	hsa-miR-371b-3p	CLIP-seq
MIRT2626746	hsa-miR-377	CLIP-seq
MIRT2626747	hsa-miR-3941	CLIP-seq
MIRT2626748	hsa-miR-4264	CLIP-seq
MIRT2626749	hsa-miR-4279	CLIP-seq
MIRT2626750	hsa-miR-4290	CLIP-seq
MIRT2626751	hsa-miR-4297	CLIP-seq
MIRT2626752	hsa-miR-4324	CLIP-seq
MIRT2626753	hsa-miR-4427	CLIP-seq
MIRT2626755	hsa-miR-4470	CLIP-seq
MIRT2626756	hsa-miR-4473	CLIP-seq
MIRT2626757	hsa-miR-4493	CLIP-seq
MIRT2626759	hsa-miR-4512	CLIP-seq
MIRT2626760	hsa-miR-452	CLIP-seq
MIRT2626761	hsa-miR-4639-3p	CLIP-seq
MIRT2626762	hsa-miR-466	CLIP-seq
MIRT2626763	hsa-miR-4670-3p	CLIP-seq
MIRT2626764	hsa-miR-4671-3p	CLIP-seq
MIRT2626765	hsa-miR-4672	CLIP-seq
MIRT2626766	hsa-miR-4676-3p	CLIP-seq
MIRT2626767	hsa-miR-4680-3p	CLIP-seq
MIRT2626768	hsa-miR-4691-3p	CLIP-seq
MIRT2626769	hsa-miR-4704-3p	CLIP-seq
MIRT2626770	hsa-miR-4717-3p	CLIP-seq
MIRT2626771	hsa-miR-4731-3p	CLIP-seq
MIRT2626773	hsa-miR-4786-3p	CLIP-seq
MIRT2626774	hsa-miR-4789-3p	CLIP-seq
MIRT2626775	hsa-miR-4797-3p	CLIP-seq
MIRT2626776	hsa-miR-4801	CLIP-seq
MIRT2626778	hsa-miR-5096	CLIP-seq
MIRT2626779	hsa-miR-513a-3p	CLIP-seq
MIRT2626780	hsa-miR-515-3p	CLIP-seq
MIRT2626781	hsa-miR-519e	CLIP-seq
MIRT1366086	hsa-miR-548c-3p	CLIP-seq
MIRT2626783	hsa-miR-579	CLIP-seq
MIRT2626784	hsa-miR-590-3p	CLIP-seq
MIRT2626785	hsa-miR-651	CLIP-seq
MIRT2626786	hsa-miR-874	CLIP-seq

Gene ontology (GO) Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003333	Process	Amino acid transmembrane transport	IEA
GO:0005295	Function	Neutral L-amino acid:sodium symporter activity	IDA	16226721
GO:0005295	Function	Neutral L-amino acid:sodium symporter activity	IEA
GO:0005298	Function	Proline:sodium symporter activity	IBA
GO:0005298	Function	Proline:sodium symporter activity	IEA
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	NAS	11112352
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0006836	Process	Neurotransmitter transport	IEA
GO:0006836	Process	Neurotransmitter transport	NAS	11112352
GO:0006865	Process	Amino acid transport	IEA
GO:0006865	Process	Amino acid transport	TAS
GO:0015171	Function	Amino acid transmembrane transporter activity	TAS
GO:0015293	Function	Symporter activity	IEA
GO:0015657	Function	Branched-chain amino acid:sodium symporter activity	IDA	16226721
GO:0015657	Function	Branched-chain amino acid:sodium symporter activity	IEA
GO:0015804	Process	Neutral amino acid transport	IDA	16226721
GO:0015804	Process	Neutral amino acid transport	IEA
GO:0015820	Process	L-leucine transport	IBA
GO:0015820	Process	L-leucine transport	IEA
GO:0015820	Process	L-leucine transport	ISS
GO:0015824	Process	Proline transport	IEA
GO:0015824	Process	Proline transport	ISS
GO:0016020	Component	Membrane	IDA	16226721
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	11112352
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0035725	Process	Sodium ion transmembrane transport	IBA
GO:1905039	Process	Carboxylic acid transmembrane transport	IEA

Other IDs

• MIM: 607971
• HGNC: 13621
• e!Ensembl: ENSG00000072041

Protein

• UniProt ID: Q9H2J7
• Protein name: Sodium-dependent neutral amino acid transporter B(0)AT2 (Sodium- and chloride-dependent neurotransmitter transporter NTT73) (Sodium-coupled branched-chain amino-acid transporter 1) (Solute carrier family 6 member 15) (Transporter v7-3)
• Protein function: Functions as a sodium-dependent neutral amino acid transporter. Exhibits preference for the branched-chain amino acids, particularly leucine, valine and isoleucine and methionine. Can also transport low-affinity substrates such as alanine, pheny
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00209	SNF	61 → 644	Sodium:neurotransmitter symporter family	Family

• Tissue specificity: TISSUE SPECIFICITY: Almost exclusively expressed in the brain. {ECO:0000269|PubMed:16226721}.
• Sequence:

  MPKNSKVVKRELDDDVTESVKDLLSNEDAADDAFKTSELIVDGQEEKDTDVEEGSEVEDE
  RPAWNSKLQYILAQVGFSVGLGNVWRFPYLCQKNGGGAYLLPYLILLMVIGIPLFFLELS
  VGQRIRRGSIGVWNYISPKLGGIGFASCVVCYFVALYYNVIIGWSLFYFSQSFQQPLPWD
  QCPLVKNASHTFVEPECEQSSATTYYWYREALNISSSISESGGLNWKMTICLLAAWVMVC
  LAMIKGIQSSGKIIYFSSLFPYVVLICFLIRAFLLNGSIDGIRHMFTPKLEIMLEPKVWR
  EAATQVFFALGLGFGGVIAFSSYNKRDNNCHFDAVLVSFINFFTSVLATLVVFAVLGFKA
  NVINEKCITQNSETIMKFLKMGNISQDIIPHHINLSTVTAEDYHLVYDIIQKVKEEEFPA
  LHLNSCKIEEELNKAVQGTGLAFIAFTEAMTHFPASPFWSVMFFLMLVNLGLGSMFGTIE
  GIVTPIVDTFKVRKEILTVICCLLAFCIGLIFVQRSGNYFVTMFDDYSATLPLLIVVILE
  NIAVCFVYGIDKFMEDLKDMLGFAPSRYYYYMWKYISPLMLLSLLIASVVNMGLSPPGYN
  AWIEDKASEEFLSYPTWGLVVCVSLVVFAILPVPVVFIVRRFNLIDDSSGNLASVTYKRG
  RVLKEPVNLEGDDTSLIHGKIPSEMPSPNFGKNIYRKQSGSPTLDTAPNGRYGIGYLMAD
  IMPDMPESDL

• Sequence length: 730

Pathways

Reactome Pathway

Amino acid transport across the plasma membrane

Na+/Cl- dependent neurotransmitter transporters

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (32)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	35589863	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	36738649	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	26542096	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	36738649	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	29059683, 32139696	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	29059683, 32139696	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	26542096	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHONDROMALACIA	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CARCINOMA	—	GWAS catalog	37965154	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	30177863	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CARCINOMA	—	GWAS catalog	30093612	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	34187846	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	30804565, 35835914	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	40829600	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	27479909, 29292387, 29728651, 29942085, 30718901, 32606422, 34045744, 34586374, 34924174, 36738649, 37464041, 38177345	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY	—	GWAS catalog	34737426	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOSITIS	—	GWAS catalog	34737426	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	30456828	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	29891935, 33627673, 37386247, 38382466, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	38839884	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	36738649	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	40341939	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	34593835	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	35893037, 36292730, 36738649, 39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	31420334	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (17)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Asthma	Asthma	BEFREE	26542096		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	37543674	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21298349, 24485021	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	22475622, 28576941, 31344373		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	23874702	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	26542096		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22475622		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	30913280	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	PSYGENET_DG	21521612, 23874702		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	21521612, 23874702, 27723767, 28576941, 28915082, 29791834		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	22475622, 28576941, 31344373		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	23874702		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	30913280	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30913280		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28793334	Inhibit	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	21521612, 22475622, 23874702		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	21521612, 22475622, 23874702, 27723767, 28915082		★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

Sort by: Blended Diseases Pathways Evidence source

SLC6A6 2 shared pathwaysAmino acid transport across the plasma membrane, Na+/Cl- dependent neurotransmitter transporters Related via 2 shared pathways including Amino acid transport across the plasma membrane, Na+/Cl- dependent neurotransmitter transporters. ACTR5 3 shared diseasesAnorexia nervosa, Obsessive-compulsive disorder, Willis-ekbom disease 3 shared evidence sourcesGWAS catalog (Anorexia nervosa), GWAS catalog (Obsessive-compulsive disorder), GWAS catalog (Willis-ekbom disease) Related via 3 shared diseases including Anorexia nervosa, Obsessive-compulsive disorder — evidence mostly GWAS catalog. GMIP 3 shared diseasesAnorexia nervosa, Depression, Obsessive-compulsive disorder 3 shared evidence sourcesGWAS catalog (Anorexia nervosa), Disgenet (Depression), GWAS catalog (Obsessive-compulsive disorder) Related via 3 shared diseases including Anorexia nervosa, Depression — evidence mostly GWAS catalog. RBKS 3 shared diseasesAnorexia nervosa, Diverticular disease, Obsessive-compulsive disorder 3 shared evidence sourcesGWAS catalog (Anorexia nervosa), GWAS catalog (Diverticular disease), GWAS catalog (Obsessive-compulsive disorder) Related via 3 shared diseases including Anorexia nervosa, Diverticular disease — evidence mostly GWAS catalog. ENOX1 3 shared diseasesAnorexia nervosa, Obsessive-compulsive disorder, Willis-ekbom disease 3 shared evidence sourcesGWAS catalog (Anorexia nervosa), GWAS catalog (Obsessive-compulsive disorder), GWAS catalog (Willis-ekbom disease) Related via 3 shared diseases including Anorexia nervosa, Obsessive-compulsive disorder — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
SLC6A6	0	[]	2	["Amino acid transport across the plasma membrane","Na+\/Cl- dependent neurotransmitter transporters"]	0	[]
ACTR5	3	["Anorexia nervosa","Obsessive-compulsive disorder","Willis-ekbom disease"]	0	[]	3	["GWAS catalog (Anorexia nervosa)","GWAS catalog (Obsessive-compulsive disorder)","GWAS catalog (Willis-ekbom disease)"]
GMIP	3	["Anorexia nervosa","Depression","Obsessive-compulsive disorder"]	0	[]	3	["GWAS catalog (Anorexia nervosa)","Disgenet (Depression)","GWAS catalog (Obsessive-compulsive disorder)"]
RBKS	3	["Anorexia nervosa","Diverticular disease","Obsessive-compulsive disorder"]	0	[]	3	["GWAS catalog (Anorexia nervosa)","GWAS catalog (Diverticular disease)","GWAS catalog (Obsessive-compulsive disorder)"]
ENOX1	3	["Anorexia nervosa","Obsessive-compulsive disorder","Willis-ekbom disease"]	0	[]	3	["GWAS catalog (Anorexia nervosa)","GWAS catalog (Obsessive-compulsive disorder)","GWAS catalog (Willis-ekbom disease)"]

Diseases Linked via Similar Genes

Bipolar disorder Linked via 5 of 5 related genesSLC6A6, ACTR5, GMIP, RBKS, ENOX1 Autism Linked via 4 of 5 related genesACTR5, GMIP, RBKS, ENOX1 Tourette syndrome Linked via 4 of 5 related genesACTR5, GMIP, RBKS, ENOX1 Myeloid leukemia Linked via 1 of 5 related genesSLC6A6 Myocardial ischemia Linked via 1 of 5 related genesSLC6A6

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Bipolar disorder	5	["SLC6A6","ACTR5","GMIP","RBKS","ENOX1"]
Autism	4	["ACTR5","GMIP","RBKS","ENOX1"]
Tourette syndrome	4	["ACTR5","GMIP","RBKS","ENOX1"]
Myeloid leukemia	1	["SLC6A6"]
Myocardial ischemia	1	["SLC6A6"]