SKP1 (S-phase kinase associated protein 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 6500
• Gene name: S-phase kinase associated protein 1
• Gene symbol: SKP1
• Synonyms (NCBI Gene): EMC19, OCP-II, OCP2, SKP1A, TCEB1L, p19A
• Chromosome: 5
• Chromosome location: 5q31.1
• Summary: This gene encodes a component of SCF complexes, which are composed of this protein, cullin 1, a ring-box protein, and one member of the F-box family of proteins. This protein binds directly to the F-box motif found in F-box proteins. SCF complexes are inv

miRNA Show/Hide all (501)

miRTarBase ID	miRNA	Experiments	Reference
MIRT038197	hsa-miR-151a-5p	CLASH	23622248
MIRT035977	hsa-miR-1301-3p	CLASH	23622248
MIRT529377	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT529376	hsa-miR-4282	PAR-CLIP	21572407
MIRT529375	hsa-miR-5692a	PAR-CLIP	21572407
MIRT529388	hsa-miR-590-3p	PAR-CLIP	22012620
MIRT529381	hsa-miR-411-5p	PAR-CLIP	22012620
MIRT529387	hsa-miR-4735-5p	PAR-CLIP	22012620
MIRT529386	hsa-miR-655-5p	PAR-CLIP	22012620
MIRT529385	hsa-miR-377-5p	PAR-CLIP	22012620
MIRT529384	hsa-miR-6086	PAR-CLIP	22012620
MIRT529383	hsa-miR-6832-5p	PAR-CLIP	22012620
MIRT529382	hsa-miR-4775	PAR-CLIP	22012620
MIRT529381	hsa-miR-411-5p	PAR-CLIP	22012620
MIRT529380	hsa-miR-197-3p	PAR-CLIP	22012620
MIRT529379	hsa-miR-3149	PAR-CLIP	22012620
MIRT529378	hsa-miR-5096	PAR-CLIP	22012620
MIRT529377	hsa-miR-548c-3p	PAR-CLIP	22012620
MIRT529376	hsa-miR-4282	PAR-CLIP	22012620
MIRT529375	hsa-miR-5692a	PAR-CLIP	22012620
MIRT529374	hsa-miR-2681-5p	PAR-CLIP	22012620
MIRT439626	hsa-miR-493-3p	HITS-CLIP	24374217
MIRT439625	hsa-miR-379-3p	HITS-CLIP	24374217
MIRT439626	hsa-miR-493-3p	HITS-CLIP	24374217
MIRT439625	hsa-miR-379-3p	HITS-CLIP	24374217
MIRT529375	hsa-miR-5692a	PAR-CLIP	27292025
MIRT529388	hsa-miR-590-3p	PAR-CLIP	27292025
MIRT529388	hsa-miR-590-3p	HITS-CLIP	27418678
MIRT732470	hsa-miR-101-3p	Immunofluorescence, Western blotting	34234930
MIRT529377	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT529376	hsa-miR-4282	PAR-CLIP	21572407
MIRT529375	hsa-miR-5692a	PAR-CLIP	21572407
MIRT529388	hsa-miR-590-3p	PAR-CLIP	22012620
MIRT529381	hsa-miR-411-5p	PAR-CLIP	22012620
MIRT529387	hsa-miR-4735-5p	PAR-CLIP	22012620
MIRT529386	hsa-miR-655-5p	PAR-CLIP	22012620
MIRT529385	hsa-miR-377-5p	PAR-CLIP	22012620
MIRT529384	hsa-miR-6086	PAR-CLIP	22012620
MIRT529383	hsa-miR-6832-5p	PAR-CLIP	22012620
MIRT529382	hsa-miR-4775	PAR-CLIP	22012620
MIRT529381	hsa-miR-411-5p	PAR-CLIP	22012620
MIRT529380	hsa-miR-197-3p	PAR-CLIP	22012620
MIRT529379	hsa-miR-3149	PAR-CLIP	22012620
MIRT529378	hsa-miR-5096	PAR-CLIP	22012620
MIRT529377	hsa-miR-548c-3p	PAR-CLIP	22012620
MIRT529376	hsa-miR-4282	PAR-CLIP	22012620
MIRT529375	hsa-miR-5692a	PAR-CLIP	22012620
MIRT529374	hsa-miR-2681-5p	PAR-CLIP	22012620
MIRT1351233	hsa-miR-4699-3p	CLIP-seq
MIRT1351234	hsa-miR-561	CLIP-seq
MIRT1351235	hsa-miR-1205	CLIP-seq
MIRT1351236	hsa-miR-1233	CLIP-seq
MIRT1351237	hsa-miR-1245b-3p	CLIP-seq
MIRT1351238	hsa-miR-1286	CLIP-seq
MIRT1351239	hsa-miR-130a	CLIP-seq
MIRT1351240	hsa-miR-130b	CLIP-seq
MIRT1351241	hsa-miR-148a	CLIP-seq
MIRT1351242	hsa-miR-148b	CLIP-seq
MIRT1351243	hsa-miR-152	CLIP-seq
MIRT1351244	hsa-miR-221	CLIP-seq
MIRT1351245	hsa-miR-222	CLIP-seq
MIRT1351246	hsa-miR-2278	CLIP-seq
MIRT1351247	hsa-miR-2682	CLIP-seq
MIRT1351248	hsa-miR-301a	CLIP-seq
MIRT1351249	hsa-miR-301b	CLIP-seq
MIRT1351250	hsa-miR-3136-5p	CLIP-seq
MIRT1351251	hsa-miR-3148	CLIP-seq
MIRT1351252	hsa-miR-3153	CLIP-seq
MIRT1351253	hsa-miR-3166	CLIP-seq
MIRT1351254	hsa-miR-3173-5p	CLIP-seq
MIRT1351255	hsa-miR-3179	CLIP-seq
MIRT1351256	hsa-miR-325	CLIP-seq
MIRT1351257	hsa-miR-3613-3p	CLIP-seq
MIRT1351258	hsa-miR-3617	CLIP-seq
MIRT1351259	hsa-miR-3618	CLIP-seq
MIRT1351260	hsa-miR-3652	CLIP-seq
MIRT1351261	hsa-miR-3666	CLIP-seq
MIRT1351262	hsa-miR-3923	CLIP-seq
MIRT1351263	hsa-miR-3925-5p	CLIP-seq
MIRT1351264	hsa-miR-3974	CLIP-seq
MIRT1351265	hsa-miR-3976	CLIP-seq
MIRT1351266	hsa-miR-4252	CLIP-seq
MIRT1351267	hsa-miR-4295	CLIP-seq
MIRT1351268	hsa-miR-4328	CLIP-seq
MIRT1351269	hsa-miR-4418	CLIP-seq
MIRT1351270	hsa-miR-4428	CLIP-seq
MIRT1351271	hsa-miR-4430	CLIP-seq
MIRT1351272	hsa-miR-4438	CLIP-seq
MIRT1351273	hsa-miR-4439	CLIP-seq
MIRT1351274	hsa-miR-4459	CLIP-seq
MIRT1351275	hsa-miR-449c	CLIP-seq
MIRT1351276	hsa-miR-4519	CLIP-seq
MIRT1351277	hsa-miR-452	CLIP-seq
MIRT1351278	hsa-miR-454	CLIP-seq
MIRT1351279	hsa-miR-4676-3p	CLIP-seq
MIRT1351280	hsa-miR-4695-5p	CLIP-seq
MIRT1351281	hsa-miR-4698	CLIP-seq
MIRT1351233	hsa-miR-4699-3p	CLIP-seq
MIRT1351282	hsa-miR-4722-5p	CLIP-seq
MIRT1351283	hsa-miR-485-5p	CLIP-seq
MIRT1351284	hsa-miR-509-3-5p	CLIP-seq
MIRT1351285	hsa-miR-5095	CLIP-seq
MIRT1351286	hsa-miR-509-5p	CLIP-seq
MIRT1351287	hsa-miR-520d-5p	CLIP-seq
MIRT1351288	hsa-miR-524-5p	CLIP-seq
MIRT1351289	hsa-miR-548v	CLIP-seq
MIRT1351290	hsa-miR-582-3p	CLIP-seq
MIRT1351291	hsa-miR-583	CLIP-seq
MIRT1351292	hsa-miR-589	CLIP-seq
MIRT1351293	hsa-miR-641	CLIP-seq
MIRT1351294	hsa-miR-7	CLIP-seq
MIRT1351295	hsa-miR-875-3p	CLIP-seq
MIRT1351296	hsa-miR-891b	CLIP-seq
MIRT1351297	hsa-miR-934	CLIP-seq
MIRT1351298	hsa-miR-940	CLIP-seq
MIRT1351299	hsa-miR-943	CLIP-seq
MIRT1557040	hsa-miR-1224-5p	CLIP-seq
MIRT1557041	hsa-miR-338-5p	CLIP-seq
MIRT1351268	hsa-miR-4328	CLIP-seq
MIRT1557042	hsa-miR-4643	CLIP-seq
MIRT1557043	hsa-miR-466	CLIP-seq
MIRT1557044	hsa-miR-4751	CLIP-seq
MIRT1557045	hsa-miR-4789-3p	CLIP-seq
MIRT1351235	hsa-miR-1205	CLIP-seq
MIRT2104081	hsa-miR-1251	CLIP-seq
MIRT1351238	hsa-miR-1286	CLIP-seq
MIRT1351239	hsa-miR-130a	CLIP-seq
MIRT1351240	hsa-miR-130b	CLIP-seq
MIRT2104082	hsa-miR-145	CLIP-seq
MIRT1351241	hsa-miR-148a	CLIP-seq
MIRT1351242	hsa-miR-148b	CLIP-seq
MIRT1351243	hsa-miR-152	CLIP-seq
MIRT1351246	hsa-miR-2278	CLIP-seq
MIRT1351247	hsa-miR-2682	CLIP-seq
MIRT2104083	hsa-miR-28-3p	CLIP-seq
MIRT1351248	hsa-miR-301a	CLIP-seq
MIRT1351249	hsa-miR-301b	CLIP-seq
MIRT1351250	hsa-miR-3136-5p	CLIP-seq
MIRT1351252	hsa-miR-3153	CLIP-seq
MIRT1351253	hsa-miR-3166	CLIP-seq
MIRT1351256	hsa-miR-325	CLIP-seq
MIRT2104084	hsa-miR-340	CLIP-seq
MIRT1351257	hsa-miR-3613-3p	CLIP-seq
MIRT1351258	hsa-miR-3617	CLIP-seq
MIRT1351260	hsa-miR-3652	CLIP-seq
MIRT2104085	hsa-miR-3654	CLIP-seq
MIRT1351261	hsa-miR-3666	CLIP-seq
MIRT2104086	hsa-miR-371-5p	CLIP-seq
MIRT1351262	hsa-miR-3923	CLIP-seq
MIRT1351263	hsa-miR-3925-5p	CLIP-seq
MIRT1351265	hsa-miR-3976	CLIP-seq
MIRT1351266	hsa-miR-4252	CLIP-seq
MIRT1351267	hsa-miR-4295	CLIP-seq
MIRT1351268	hsa-miR-4328	CLIP-seq
MIRT1351269	hsa-miR-4418	CLIP-seq
MIRT1351271	hsa-miR-4430	CLIP-seq
MIRT1351273	hsa-miR-4439	CLIP-seq
MIRT1351274	hsa-miR-4459	CLIP-seq
MIRT2104087	hsa-miR-4464	CLIP-seq
MIRT1351275	hsa-miR-449c	CLIP-seq
MIRT1351276	hsa-miR-4519	CLIP-seq
MIRT1351278	hsa-miR-454	CLIP-seq
MIRT2104088	hsa-miR-4638-3p	CLIP-seq
MIRT1557042	hsa-miR-4643	CLIP-seq
MIRT1557043	hsa-miR-466	CLIP-seq
MIRT1351280	hsa-miR-4695-5p	CLIP-seq
MIRT1351281	hsa-miR-4698	CLIP-seq
MIRT1351233	hsa-miR-4699-3p	CLIP-seq
MIRT1351282	hsa-miR-4722-5p	CLIP-seq
MIRT2104089	hsa-miR-4748	CLIP-seq
MIRT1557045	hsa-miR-4789-3p	CLIP-seq
MIRT1351283	hsa-miR-485-5p	CLIP-seq
MIRT2104090	hsa-miR-487a	CLIP-seq
MIRT2104091	hsa-miR-500a	CLIP-seq
MIRT1351284	hsa-miR-509-3-5p	CLIP-seq
MIRT1351286	hsa-miR-509-5p	CLIP-seq
MIRT1351287	hsa-miR-520d-5p	CLIP-seq
MIRT1351288	hsa-miR-524-5p	CLIP-seq
MIRT1351234	hsa-miR-561	CLIP-seq
MIRT1351290	hsa-miR-582-3p	CLIP-seq
MIRT2104092	hsa-miR-582-5p	CLIP-seq
MIRT1351291	hsa-miR-583	CLIP-seq
MIRT2104093	hsa-miR-587	CLIP-seq
MIRT1351292	hsa-miR-589	CLIP-seq
MIRT2104094	hsa-miR-600	CLIP-seq
MIRT2104095	hsa-miR-627	CLIP-seq
MIRT1351293	hsa-miR-641	CLIP-seq
MIRT2104096	hsa-miR-645	CLIP-seq
MIRT1351294	hsa-miR-7	CLIP-seq
MIRT2104097	hsa-miR-802	CLIP-seq
MIRT1351296	hsa-miR-891b	CLIP-seq
MIRT2104098	hsa-miR-924	CLIP-seq
MIRT1351298	hsa-miR-940	CLIP-seq
MIRT1351299	hsa-miR-943	CLIP-seq
MIRT1351235	hsa-miR-1205	CLIP-seq
MIRT1557040	hsa-miR-1224-5p	CLIP-seq
MIRT2328196	hsa-miR-1264	CLIP-seq
MIRT1351238	hsa-miR-1286	CLIP-seq
MIRT2328197	hsa-miR-1305	CLIP-seq
MIRT1351239	hsa-miR-130a	CLIP-seq
MIRT1351240	hsa-miR-130b	CLIP-seq
MIRT1351241	hsa-miR-148a	CLIP-seq
MIRT1351242	hsa-miR-148b	CLIP-seq
MIRT1351243	hsa-miR-152	CLIP-seq
MIRT2328198	hsa-miR-1825	CLIP-seq
MIRT2328199	hsa-miR-188-3p	CLIP-seq
MIRT2328200	hsa-miR-199a-5p	CLIP-seq
MIRT2328201	hsa-miR-199b-5p	CLIP-seq
MIRT1351246	hsa-miR-2278	CLIP-seq
MIRT2104083	hsa-miR-28-3p	CLIP-seq
MIRT1351248	hsa-miR-301a	CLIP-seq
MIRT1351249	hsa-miR-301b	CLIP-seq
MIRT2328202	hsa-miR-3122	CLIP-seq
MIRT1351250	hsa-miR-3136-5p	CLIP-seq
MIRT1351256	hsa-miR-325	CLIP-seq
MIRT1557041	hsa-miR-338-5p	CLIP-seq
MIRT2104084	hsa-miR-340	CLIP-seq
MIRT1351258	hsa-miR-3617	CLIP-seq
MIRT1351259	hsa-miR-3618	CLIP-seq
MIRT1351260	hsa-miR-3652	CLIP-seq
MIRT2104085	hsa-miR-3654	CLIP-seq
MIRT1351261	hsa-miR-3666	CLIP-seq
MIRT2328203	hsa-miR-3682-5p	CLIP-seq
MIRT2328204	hsa-miR-374c	CLIP-seq
MIRT2328205	hsa-miR-3913-3p	CLIP-seq
MIRT2328206	hsa-miR-3913-5p	CLIP-seq
MIRT1351262	hsa-miR-3923	CLIP-seq
MIRT2328207	hsa-miR-3925-3p	CLIP-seq
MIRT1351263	hsa-miR-3925-5p	CLIP-seq
MIRT1351264	hsa-miR-3974	CLIP-seq
MIRT1351265	hsa-miR-3976	CLIP-seq
MIRT2328208	hsa-miR-409-3p	CLIP-seq
MIRT1351266	hsa-miR-4252	CLIP-seq
MIRT2328209	hsa-miR-4269	CLIP-seq
MIRT1351267	hsa-miR-4295	CLIP-seq
MIRT1351268	hsa-miR-4328	CLIP-seq
MIRT1351269	hsa-miR-4418	CLIP-seq
MIRT1351271	hsa-miR-4430	CLIP-seq
MIRT1351272	hsa-miR-4438	CLIP-seq
MIRT1351273	hsa-miR-4439	CLIP-seq
MIRT1351274	hsa-miR-4459	CLIP-seq
MIRT2104087	hsa-miR-4464	CLIP-seq
MIRT2328210	hsa-miR-450b-3p	CLIP-seq
MIRT2328211	hsa-miR-4514	CLIP-seq
MIRT1351276	hsa-miR-4519	CLIP-seq
MIRT1351277	hsa-miR-452	CLIP-seq
MIRT1351278	hsa-miR-454	CLIP-seq
MIRT2104088	hsa-miR-4638-3p	CLIP-seq
MIRT1557042	hsa-miR-4643	CLIP-seq
MIRT1557043	hsa-miR-466	CLIP-seq
MIRT2328212	hsa-miR-4666-3p	CLIP-seq
MIRT1351279	hsa-miR-4676-3p	CLIP-seq
MIRT2328213	hsa-miR-4692	CLIP-seq
MIRT1351280	hsa-miR-4695-5p	CLIP-seq
MIRT1351281	hsa-miR-4698	CLIP-seq
MIRT1351233	hsa-miR-4699-3p	CLIP-seq
MIRT2328214	hsa-miR-4713-3p	CLIP-seq
MIRT2328215	hsa-miR-4717-3p	CLIP-seq
MIRT1351282	hsa-miR-4722-5p	CLIP-seq
MIRT2328216	hsa-miR-4742-5p	CLIP-seq
MIRT2104089	hsa-miR-4748	CLIP-seq
MIRT1557044	hsa-miR-4751	CLIP-seq
MIRT2328217	hsa-miR-4778-5p	CLIP-seq
MIRT1557045	hsa-miR-4789-3p	CLIP-seq
MIRT1351283	hsa-miR-485-5p	CLIP-seq
MIRT2104090	hsa-miR-487a	CLIP-seq
MIRT2328218	hsa-miR-489	CLIP-seq
MIRT2328219	hsa-miR-498	CLIP-seq
MIRT2104091	hsa-miR-500a	CLIP-seq
MIRT1351284	hsa-miR-509-3-5p	CLIP-seq
MIRT1351285	hsa-miR-5095	CLIP-seq
MIRT1351286	hsa-miR-509-5p	CLIP-seq
MIRT1351234	hsa-miR-561	CLIP-seq
MIRT1351290	hsa-miR-582-3p	CLIP-seq
MIRT2104092	hsa-miR-582-5p	CLIP-seq
MIRT2104093	hsa-miR-587	CLIP-seq
MIRT1351292	hsa-miR-589	CLIP-seq
MIRT2328220	hsa-miR-595	CLIP-seq
MIRT2104094	hsa-miR-600	CLIP-seq
MIRT2328221	hsa-miR-610	CLIP-seq
MIRT2328222	hsa-miR-638	CLIP-seq
MIRT1351293	hsa-miR-641	CLIP-seq
MIRT2328223	hsa-miR-655	CLIP-seq
MIRT1351294	hsa-miR-7	CLIP-seq
MIRT2328224	hsa-miR-769-3p	CLIP-seq
MIRT1351296	hsa-miR-891b	CLIP-seq
MIRT1351297	hsa-miR-934	CLIP-seq
MIRT1351299	hsa-miR-943	CLIP-seq
MIRT1351247	hsa-miR-2682	CLIP-seq
MIRT1351253	hsa-miR-3166	CLIP-seq
MIRT1351275	hsa-miR-449c	CLIP-seq
MIRT1351298	hsa-miR-940	CLIP-seq
MIRT1351263	hsa-miR-3925-5p	CLIP-seq
MIRT1351265	hsa-miR-3976	CLIP-seq
MIRT1351266	hsa-miR-4252	CLIP-seq
MIRT1351268	hsa-miR-4328	CLIP-seq
MIRT1351292	hsa-miR-589	CLIP-seq
MIRT1351252	hsa-miR-3153	CLIP-seq
MIRT1351266	hsa-miR-4252	CLIP-seq
MIRT1351281	hsa-miR-4698	CLIP-seq
MIRT1351235	hsa-miR-1205	CLIP-seq
MIRT1557040	hsa-miR-1224-5p	CLIP-seq
MIRT1351236	hsa-miR-1233	CLIP-seq
MIRT1351237	hsa-miR-1245b-3p	CLIP-seq
MIRT2104081	hsa-miR-1251	CLIP-seq
MIRT1351238	hsa-miR-1286	CLIP-seq
MIRT1351239	hsa-miR-130a	CLIP-seq
MIRT1351240	hsa-miR-130b	CLIP-seq
MIRT2104082	hsa-miR-145	CLIP-seq
MIRT1351241	hsa-miR-148a	CLIP-seq
MIRT1351242	hsa-miR-148b	CLIP-seq
MIRT1351243	hsa-miR-152	CLIP-seq
MIRT2623057	hsa-miR-186	CLIP-seq
MIRT2328199	hsa-miR-188-3p	CLIP-seq
MIRT2623058	hsa-miR-198	CLIP-seq
MIRT2623059	hsa-miR-2053	CLIP-seq
MIRT1351244	hsa-miR-221	CLIP-seq
MIRT1351245	hsa-miR-222	CLIP-seq
MIRT1351246	hsa-miR-2278	CLIP-seq
MIRT2104083	hsa-miR-28-3p	CLIP-seq
MIRT1351248	hsa-miR-301a	CLIP-seq
MIRT1351249	hsa-miR-301b	CLIP-seq
MIRT2328202	hsa-miR-3122	CLIP-seq
MIRT2623060	hsa-miR-3133	CLIP-seq
MIRT1351250	hsa-miR-3136-5p	CLIP-seq
MIRT2623061	hsa-miR-3159	CLIP-seq
MIRT1351254	hsa-miR-3173-5p	CLIP-seq
MIRT1351255	hsa-miR-3179	CLIP-seq
MIRT2623062	hsa-miR-3180-5p	CLIP-seq
MIRT1351256	hsa-miR-325	CLIP-seq
MIRT1557041	hsa-miR-338-5p	CLIP-seq
MIRT2104084	hsa-miR-340	CLIP-seq
MIRT1351257	hsa-miR-3613-3p	CLIP-seq
MIRT1351258	hsa-miR-3617	CLIP-seq
MIRT1351259	hsa-miR-3618	CLIP-seq
MIRT1351260	hsa-miR-3652	CLIP-seq
MIRT1351261	hsa-miR-3666	CLIP-seq
MIRT2104086	hsa-miR-371-5p	CLIP-seq
MIRT2328204	hsa-miR-374c	CLIP-seq
MIRT2328205	hsa-miR-3913-3p	CLIP-seq
MIRT2328206	hsa-miR-3913-5p	CLIP-seq
MIRT1351262	hsa-miR-3923	CLIP-seq
MIRT1351263	hsa-miR-3925-5p	CLIP-seq
MIRT1351265	hsa-miR-3976	CLIP-seq
MIRT1351266	hsa-miR-4252	CLIP-seq
MIRT1351267	hsa-miR-4295	CLIP-seq
MIRT1351268	hsa-miR-4328	CLIP-seq
MIRT2623063	hsa-miR-4330	CLIP-seq
MIRT1351269	hsa-miR-4418	CLIP-seq
MIRT1351271	hsa-miR-4430	CLIP-seq
MIRT1351272	hsa-miR-4438	CLIP-seq
MIRT1351273	hsa-miR-4439	CLIP-seq
MIRT1351274	hsa-miR-4459	CLIP-seq
MIRT2104087	hsa-miR-4464	CLIP-seq
MIRT2328210	hsa-miR-450b-3p	CLIP-seq
MIRT1351276	hsa-miR-4519	CLIP-seq
MIRT1351277	hsa-miR-452	CLIP-seq
MIRT1351278	hsa-miR-454	CLIP-seq
MIRT1557042	hsa-miR-4643	CLIP-seq
MIRT1557043	hsa-miR-466	CLIP-seq
MIRT2328212	hsa-miR-4666-3p	CLIP-seq
MIRT1351279	hsa-miR-4676-3p	CLIP-seq
MIRT1351280	hsa-miR-4695-5p	CLIP-seq
MIRT2623064	hsa-miR-4711-3p	CLIP-seq
MIRT2328214	hsa-miR-4713-3p	CLIP-seq
MIRT2328215	hsa-miR-4717-3p	CLIP-seq
MIRT1351282	hsa-miR-4722-5p	CLIP-seq
MIRT2104089	hsa-miR-4748	CLIP-seq
MIRT1557044	hsa-miR-4751	CLIP-seq
MIRT2328217	hsa-miR-4778-5p	CLIP-seq
MIRT1557045	hsa-miR-4789-3p	CLIP-seq
MIRT1351283	hsa-miR-485-5p	CLIP-seq
MIRT2104090	hsa-miR-487a	CLIP-seq
MIRT2328218	hsa-miR-489	CLIP-seq
MIRT2104091	hsa-miR-500a	CLIP-seq
MIRT1351284	hsa-miR-509-3-5p	CLIP-seq
MIRT1351285	hsa-miR-5095	CLIP-seq
MIRT1351286	hsa-miR-509-5p	CLIP-seq
MIRT2623065	hsa-miR-511	CLIP-seq
MIRT2623066	hsa-miR-520a-5p	CLIP-seq
MIRT2623067	hsa-miR-525-5p	CLIP-seq
MIRT2623068	hsa-miR-548a-3p	CLIP-seq
MIRT2623069	hsa-miR-548e	CLIP-seq
MIRT2623070	hsa-miR-548f	CLIP-seq
MIRT1351289	hsa-miR-548v	CLIP-seq
MIRT2623071	hsa-miR-569	CLIP-seq
MIRT2623072	hsa-miR-570	CLIP-seq
MIRT2104092	hsa-miR-582-5p	CLIP-seq
MIRT2104093	hsa-miR-587	CLIP-seq
MIRT1351292	hsa-miR-589	CLIP-seq
MIRT2328220	hsa-miR-595	CLIP-seq
MIRT2104094	hsa-miR-600	CLIP-seq
MIRT2104095	hsa-miR-627	CLIP-seq
MIRT2328222	hsa-miR-638	CLIP-seq
MIRT1351293	hsa-miR-641	CLIP-seq
MIRT2104096	hsa-miR-645	CLIP-seq
MIRT2328223	hsa-miR-655	CLIP-seq
MIRT1351294	hsa-miR-7	CLIP-seq
MIRT2328224	hsa-miR-769-3p	CLIP-seq
MIRT1351296	hsa-miR-891b	CLIP-seq
MIRT2104098	hsa-miR-924	CLIP-seq
MIRT1351297	hsa-miR-934	CLIP-seq
MIRT2623073	hsa-miR-935	CLIP-seq
MIRT1351299	hsa-miR-943	CLIP-seq
MIRT1351235	hsa-miR-1205	CLIP-seq
MIRT1557040	hsa-miR-1224-5p	CLIP-seq
MIRT1351236	hsa-miR-1233	CLIP-seq
MIRT1351237	hsa-miR-1245b-3p	CLIP-seq
MIRT2104081	hsa-miR-1251	CLIP-seq
MIRT1351238	hsa-miR-1286	CLIP-seq
MIRT1351239	hsa-miR-130a	CLIP-seq
MIRT1351240	hsa-miR-130b	CLIP-seq
MIRT1351241	hsa-miR-148a	CLIP-seq
MIRT1351242	hsa-miR-148b	CLIP-seq
MIRT1351243	hsa-miR-152	CLIP-seq
MIRT2623057	hsa-miR-186	CLIP-seq
MIRT2328199	hsa-miR-188-3p	CLIP-seq
MIRT2690815	hsa-miR-18a	CLIP-seq
MIRT2690816	hsa-miR-18b	CLIP-seq
MIRT1351244	hsa-miR-221	CLIP-seq
MIRT1351245	hsa-miR-222	CLIP-seq
MIRT1351246	hsa-miR-2278	CLIP-seq
MIRT2104083	hsa-miR-28-3p	CLIP-seq
MIRT1351248	hsa-miR-301a	CLIP-seq
MIRT1351249	hsa-miR-301b	CLIP-seq
MIRT2328202	hsa-miR-3122	CLIP-seq
MIRT2623060	hsa-miR-3133	CLIP-seq
MIRT1351250	hsa-miR-3136-5p	CLIP-seq
MIRT2623061	hsa-miR-3159	CLIP-seq
MIRT1351254	hsa-miR-3173-5p	CLIP-seq
MIRT1351255	hsa-miR-3179	CLIP-seq
MIRT2690817	hsa-miR-3199	CLIP-seq
MIRT1557041	hsa-miR-338-5p	CLIP-seq
MIRT2104084	hsa-miR-340	CLIP-seq
MIRT1351258	hsa-miR-3617	CLIP-seq
MIRT1351259	hsa-miR-3618	CLIP-seq
MIRT1351260	hsa-miR-3652	CLIP-seq
MIRT1351261	hsa-miR-3666	CLIP-seq
MIRT2104086	hsa-miR-371-5p	CLIP-seq
MIRT2328204	hsa-miR-374c	CLIP-seq
MIRT2328205	hsa-miR-3913-3p	CLIP-seq
MIRT2328206	hsa-miR-3913-5p	CLIP-seq
MIRT1351262	hsa-miR-3923	CLIP-seq
MIRT1351263	hsa-miR-3925-5p	CLIP-seq
MIRT1351265	hsa-miR-3976	CLIP-seq
MIRT1351266	hsa-miR-4252	CLIP-seq
MIRT1351267	hsa-miR-4295	CLIP-seq
MIRT1351268	hsa-miR-4328	CLIP-seq
MIRT2623063	hsa-miR-4330	CLIP-seq
MIRT1351269	hsa-miR-4418	CLIP-seq
MIRT1351271	hsa-miR-4430	CLIP-seq
MIRT1351272	hsa-miR-4438	CLIP-seq
MIRT1351273	hsa-miR-4439	CLIP-seq
MIRT1351274	hsa-miR-4459	CLIP-seq
MIRT2104087	hsa-miR-4464	CLIP-seq
MIRT2690818	hsa-miR-4477a	CLIP-seq
MIRT2328210	hsa-miR-450b-3p	CLIP-seq
MIRT1351276	hsa-miR-4519	CLIP-seq
MIRT1351277	hsa-miR-452	CLIP-seq
MIRT1351278	hsa-miR-454	CLIP-seq
MIRT1557042	hsa-miR-4643	CLIP-seq
MIRT1557043	hsa-miR-466	CLIP-seq
MIRT2328212	hsa-miR-4666-3p	CLIP-seq
MIRT1351279	hsa-miR-4676-3p	CLIP-seq
MIRT1351280	hsa-miR-4695-5p	CLIP-seq
MIRT2623064	hsa-miR-4711-3p	CLIP-seq
MIRT2328214	hsa-miR-4713-3p	CLIP-seq
MIRT2328215	hsa-miR-4717-3p	CLIP-seq
MIRT1351282	hsa-miR-4722-5p	CLIP-seq
MIRT2690819	hsa-miR-4735-3p	CLIP-seq
MIRT2104089	hsa-miR-4748	CLIP-seq
MIRT1557044	hsa-miR-4751	CLIP-seq
MIRT2328217	hsa-miR-4778-5p	CLIP-seq
MIRT1557045	hsa-miR-4789-3p	CLIP-seq
MIRT1351283	hsa-miR-485-5p	CLIP-seq
MIRT2104090	hsa-miR-487a	CLIP-seq
MIRT2328218	hsa-miR-489	CLIP-seq
MIRT2104091	hsa-miR-500a	CLIP-seq
MIRT1351284	hsa-miR-509-3-5p	CLIP-seq
MIRT1351285	hsa-miR-5095	CLIP-seq
MIRT1351286	hsa-miR-509-5p	CLIP-seq
MIRT2623065	hsa-miR-511	CLIP-seq
MIRT2623068	hsa-miR-548a-3p	CLIP-seq
MIRT2623069	hsa-miR-548e	CLIP-seq
MIRT2623070	hsa-miR-548f	CLIP-seq
MIRT1351289	hsa-miR-548v	CLIP-seq
MIRT2623072	hsa-miR-570	CLIP-seq
MIRT2104093	hsa-miR-587	CLIP-seq
MIRT1351292	hsa-miR-589	CLIP-seq
MIRT2328220	hsa-miR-595	CLIP-seq
MIRT2104095	hsa-miR-627	CLIP-seq
MIRT2328222	hsa-miR-638	CLIP-seq
MIRT1351293	hsa-miR-641	CLIP-seq
MIRT2104096	hsa-miR-645	CLIP-seq
MIRT2328223	hsa-miR-655	CLIP-seq
MIRT1351294	hsa-miR-7	CLIP-seq
MIRT2328224	hsa-miR-769-3p	CLIP-seq
MIRT1351296	hsa-miR-891b	CLIP-seq
MIRT2104098	hsa-miR-924	CLIP-seq
MIRT1351297	hsa-miR-934	CLIP-seq
MIRT1351299	hsa-miR-943	CLIP-seq

Gene ontology (GO) Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IDA	12820959
GO:0005515	Function	Protein binding	IPI	11099048, 11238952, 12504026, 12609982, 12813041, 14685242, 15070733, 16278047, 16376880, 16797541, 16880511, 16943429, 17098746, 17274640, 17290223, 17380122, 17389369, 17510365, 18203720, 18239684, 18660753, 18667692, 18818696, 18929646, 19159283, 19412162, 19615732, 19762597, 199
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	15145941
GO:0005634	Component	Nucleus	IDA	18929646, 21378169
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IC	29997255
GO:0005737	Component	Cytoplasm	IDA	18929646, 21378169
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006338	Process	Chromatin remodeling	IDA	16943429
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0006513	Process	Protein monoubiquitination	IEA
GO:0006915	Process	Apoptotic process	IDA	34480022
GO:0008013	Function	Beta-catenin binding	IDA	12820959
GO:0016567	Process	Protein ubiquitination	IDA	15103331
GO:0016567	Process	Protein ubiquitination	IEA
GO:0019005	Component	SCF ubiquitin ligase complex	IDA	11956208, 12820959, 15103331, 15145941, 15996101, 16880511, 20347421, 20596027, 21572392, 21725316, 23263282, 25585578, 28007894, 31413110
GO:0019005	Component	SCF ubiquitin ligase complex	IEA
GO:0019904	Function	Protein domain specific binding	IPI	15996101
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	15103331, 20347421
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0031467	Component	Cul7-RING ubiquitin ligase complex	IDA	18498745, 21572988
GO:0031467	Component	Cul7-RING ubiquitin ligase complex	IEA
GO:0031519	Component	PcG protein complex	IDA	16943429
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	34480022
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	15145941, 34480022
GO:0051457	Process	Maintenance of protein location in nucleus	IPI	21378169
GO:0061564	Process	Axon development	ISS	30304512
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	15103331, 23263282, 29997255, 34480022
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	15145941, 23263282, 29997255
GO:0070936	Process	Protein K48-linked ubiquitination	IEA
GO:0097602	Function	Cullin family protein binding	IBA
GO:0097602	Function	Cullin family protein binding	IPI	18929646
GO:0140677	Function	Molecular function activator activity	IDA	29997255
GO:0160072	Function	Ubiquitin ligase complex scaffold activity	IDA	15145941, 23263282
GO:1904037	Process	Positive regulation of epithelial cell apoptotic process	IDA	34480022
GO:1990444	Function	F-box domain binding	IPI	12820959
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IDA	12820959
GO:1990757	Function	Ubiquitin ligase activator activity	IDA	12820959

Other IDs

• MIM: 601434
• HGNC: 10899
• e!Ensembl: ENSG00000113558

Protein

• UniProt ID: P63208
• Protein name: S-phase kinase-associated protein 1 (Cyclin-A/CDK2-associated protein p19) (p19A) (Organ of Corti protein 2) (OCP-2) (Organ of Corti protein II) (OCP-II) (RNA polymerase II elongation factor-like protein) (SIII) (Transcription elongation factor B polypept
• Protein function: Essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. In the SCF complex, serves as an adapter
• PDB: 1FQV , 1FS1 , 1FS2 , 1LDK , 1P22 , 2ASS , 2AST , 2E31 , 2E32 , 2OVP , 2OVQ , 2OVR , 3L2O , 3WSO , 4I6J , 5IBK , 5JH5 , 5K35 , 5V4B , 5VZT , 5VZU , 5XYL , 6BVA , 6BYH , 6C16 , 6M90 , 6M91 , 6M92 , 6M93 , 6M94 , 6O60 , 6TTU , 6VCD , 6W66 , 6WCQ , 6WNX , 7B5L , 7B5M , 7B5R , 7T1Y , 7T1Z , 7Z8B , 7Z8T , 7Z8V , 7ZBW , 7ZBZ , 8BYA , 8BYL , 8CDJ , 8CDK , 8OR0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01466	Skp1	113 → 160	Skp1 family, dimerisation domain	Domain
  PF03931	Skp1_POZ	2 → 67	Skp1 family, tetramerisation domain	Domain

• Sequence:

  MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
  WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
  KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK

• Sequence length: 163

Pathways

KEGG Pathway	Reactome Pathway
Polycomb repressive complex	Activation of NF-kappaB in B cells
Cell cycle	Prolactin receptor signaling
Oocyte meiosis	SCF-beta-TrCP mediated degradation of Emi1
Ubiquitin mediated proteolysis	Vpu mediated degradation of CD4
Protein processing in endoplasmic reticulum	SCF(Skp2)-mediated degradation of p27/p21
Wnt signaling pathway	Degradation of beta-catenin by the destruction complex
TGF-beta signaling pathway	Downstream TCR signaling
Circadian rhythm	Regulation of PLK1 Activity at G2/M Transition
Shigellosis	Constitutive Signaling by NOTCH1 PEST Domain Mutants
Salmonella infection	Loss of Function of FBXW7 in Cancer and NOTCH1 Signaling
Human immunodeficiency virus 1 infection	FCERI mediated NF-kB activation
Pathways in cancer	Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
	Dectin-1 mediated noncanonical NF-kB signaling
	CLEC7A (Dectin-1) signaling
	Degradation of GLI1 by the proteasome
	GLI3 is processed to GLI3R by the proteasome
	NIK-->noncanonical NF-kB signaling
	MAP3K8 (TPL2)-dependent MAPK1/3 activation
	Orc1 removal from chromatin
	Cyclin D associated events in G1
	FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
	Regulation of RUNX2 expression and activity
	Neddylation
	Interleukin-1 signaling
	Iron uptake and transport
	Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Keratoconus 1	Uncertain significance	ClinVar Disgenet	—	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)

Associations from Text Mining Show/Hide Text Mining Associations (32)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30728155		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30809972		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27251275	Associate	★☆☆☆☆ Found in Text Mining only
Brugada Syndrome (disorder)	Brugada Syndrome	BEFREE	29608225		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	9736735	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27835873		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	33731859	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34237211	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	31677940		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	24035998		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	30535233		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	23171848		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21466614	Associate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	27703147	Associate	★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	23171848		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27835873		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	23522382		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24035998, 27156687, 27238229, 29291974, 30745851, 31024008, 31308089		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	30250603		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	19716805		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15075339, 21282377, 25753158, 30728155, 31677940		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	21523764, 31167929		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	15075339, 33731859	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	22166427, 23046827, 23988235, 27689878		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	22166427		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	34347012	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	27206773		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	31161818		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29916534, 32064753	Associate	★☆☆☆☆ Found in Text Mining only
Tachycardia, Ventricular	Ventricular tachycardia	BEFREE	29608225		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	36694914	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33656636	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

CUL1 33 shared pathwaysCell cycle, Oocyte meiosis, Ubiquitin mediated proteolysis, Protein processing in endoplasmic reticulum, Wnt signaling pathway, TGF-beta signaling pathway, Circadian rhythm, Shigellosis, Human immunodeficiency virus 1 infection, Constitutive Signaling by NOTCH1 PEST Domain Mutants, Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants, Neddylation +21 more Related via 33 shared pathways including Cell cycle, Oocyte meiosis. BTRC 22 shared pathwaysOocyte meiosis, Ubiquitin mediated proteolysis, Wnt signaling pathway, Circadian rhythm, Shigellosis, Human immunodeficiency virus 1 infection, Neddylation, Regulation of PLK1 Activity at G2/M Transition, Activation of NF-kappaB in B cells, SCF-beta-TrCP mediated degradation of Emi1, Vpu mediated degradation of CD4, Degradation of beta-catenin by the destruction complex +10 more Related via 22 shared pathways including Oocyte meiosis, Ubiquitin mediated proteolysis. RBX1 21 shared pathwaysCell cycle, Oocyte meiosis, Ubiquitin mediated proteolysis, Protein processing in endoplasmic reticulum, Wnt signaling pathway, TGF-beta signaling pathway, Circadian rhythm, Shigellosis, Human immunodeficiency virus 1 infection, Constitutive Signaling by NOTCH1 PEST Domain Mutants, Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants, Neddylation +9 more Related via 21 shared pathways including Cell cycle, Oocyte meiosis. FBXW11 15 shared pathwaysOocyte meiosis, Ubiquitin mediated proteolysis, Wnt signaling pathway, Circadian rhythm, Shigellosis, Human immunodeficiency virus 1 infection, Neddylation, Regulation of PLK1 Activity at G2/M Transition, Activation of NF-kappaB in B cells, Downstream TCR signaling, FCERI mediated NF-kB activation, Dectin-1 mediated noncanonical NF-kB signaling +3 more Related via 15 shared pathways including Oocyte meiosis, Ubiquitin mediated proteolysis. PSMD5 17 shared pathwaysNeddylation, SCF(Skp2)-mediated degradation of p27/p21, Orc1 removal from chromatin, Activation of NF-kappaB in B cells, SCF-beta-TrCP mediated degradation of Emi1, Vpu mediated degradation of CD4, Degradation of beta-catenin by the destruction complex, Downstream TCR signaling, FCERI mediated NF-kB activation, Dectin-1 mediated noncanonical NF-kB signaling, CLEC7A (Dectin-1) signaling, Degradation of GLI1 by the proteasome +5 more Related via 17 shared pathways including Neddylation, SCF(Skp2)-mediated degradation of p27/p21.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CUL1	0	[]	33	["Cell cycle","Oocyte meiosis","Ubiquitin mediated proteolysis","Protein processing in endoplasmic reticulum","Wnt signaling pathway","TGF-beta signaling pathway","Circadian rhythm","Shigellosis","Human immunodeficiency virus 1 infection","Constitutive Signaling by NOTCH1 PEST Domain Mutants","Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants","Neddylation"]	0	[]
BTRC	0	[]	22	["Oocyte meiosis","Ubiquitin mediated proteolysis","Wnt signaling pathway","Circadian rhythm","Shigellosis","Human immunodeficiency virus 1 infection","Neddylation","Regulation of PLK1 Activity at G2\/M Transition","Activation of NF-kappaB in B cells","SCF-beta-TrCP mediated degradation of Emi1","Vpu mediated degradation of CD4","Degradation of beta-catenin by the destruction complex"]	0	[]
RBX1	0	[]	21	["Cell cycle","Oocyte meiosis","Ubiquitin mediated proteolysis","Protein processing in endoplasmic reticulum","Wnt signaling pathway","TGF-beta signaling pathway","Circadian rhythm","Shigellosis","Human immunodeficiency virus 1 infection","Constitutive Signaling by NOTCH1 PEST Domain Mutants","Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants","Neddylation"]	0	[]
FBXW11	0	[]	15	["Oocyte meiosis","Ubiquitin mediated proteolysis","Wnt signaling pathway","Circadian rhythm","Shigellosis","Human immunodeficiency virus 1 infection","Neddylation","Regulation of PLK1 Activity at G2\/M Transition","Activation of NF-kappaB in B cells","Downstream TCR signaling","FCERI mediated NF-kB activation","Dectin-1 mediated noncanonical NF-kB signaling"]	0	[]
PSMD5	0	[]	17	["Neddylation","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin","Activation of NF-kappaB in B cells","SCF-beta-TrCP mediated degradation of Emi1","Vpu mediated degradation of CD4","Degradation of beta-catenin by the destruction complex","Downstream TCR signaling","FCERI mediated NF-kB activation","Dectin-1 mediated noncanonical NF-kB signaling","CLEC7A (Dectin-1) signaling","Degradation of GLI1 by the proteasome"]	0	[]

Diseases Linked via Similar Genes

Crohn disease Linked via 3 of 5 related genesCUL1, BTRC, RBX1 Inflammatory bowel disease Linked via 3 of 5 related genesCUL1, BTRC, RBX1 Central nervous system cancer Linked via 2 of 5 related genesCUL1, FBXW11 Glioblastoma Linked via 2 of 5 related genesCUL1, FBXW11 Glioma Linked via 2 of 5 related genesCUL1, FBXW11

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Crohn disease	3	["CUL1","BTRC","RBX1"]
Inflammatory bowel disease	3	["CUL1","BTRC","RBX1"]
Central nervous system cancer	2	["CUL1","FBXW11"]
Glioblastoma	2	["CUL1","FBXW11"]
Glioma	2	["CUL1","FBXW11"]