SF3B6 (splicing factor 3b subunit 6)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 51639
Gene name Splicing factor 3b subunit 6
Gene symbol SF3B6
Synonyms (NCBI Gene)
CGI-110HSPC175Ht006P14SAP14SAP14aSF3B14SF3B14a
Chromosome 2
Chromosome location 2p23.3
Summary This gene encodes a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subu
miRNA miRNA information provided by mirtarbase database.
7 Show/Hide all (7)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT753891 hsa-miR-4803 PAR-CLIP 20371350
MIRT753892 hsa-miR-6882-5p PAR-CLIP 20371350
MIRT753893 hsa-miR-4719 PAR-CLIP 20371350
MIRT753894 hsa-miR-187-5p PAR-CLIP 20371350
MIRT753895 hsa-miR-3143 PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24 Show/Hide all (24)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000398 Process MRNA splicing, via spliceosome IDA 27720643, 32494006, 34822310
GO:0000398 Process MRNA splicing, via spliceosome IEA
GO:0000398 Process MRNA splicing, via spliceosome IEA
GO:0000398 Process MRNA splicing, via spliceosome NAS 31744343
GO:0001825 Process Blastocyst formation IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
607835 30096 ENSG00000115128
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y3B4
Protein name Splicing factor 3B subunit 6 (Pre-mRNA branch site protein p14) (SF3b 14 kDa subunit) (SF3B14a) (Spliceosome-associated protein, 14-kDa) (Splicing factor 3b, subunit 6, 14kDa)
Protein function Component of the 17S U2 SnRNP complex of the spliceosome, a large ribonucleoprotein complex that removes introns from transcribed pre-mRNAs (PubMed:12234937, PubMed:27720643, PubMed:32494006, PubMed:34822310). The 17S U2 SnRNP complex (1) direct
PDB 2F9D , 2F9J , 2FHO , 3LQV , 5Z56 , 5Z57 , 5Z58 , 6AH0 , 6AHD , 6FF4 , 6FF7 , 6Y53 , 6Y5Q , 7ABG , 7ABH , 7ABI , 7DVQ , 7Q4O , 8H6E , 8H6J , 8H6K , 8H6L , 8I0P , 8I0R , 8QO9 , 8QXD , 8QZS , 8R08 , 8R09 , 8R0A , 8R0B , 8RM5 , 8Y7E
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 21 → 88 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Sequence 
MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTA
YVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGIN
TDPPK
Sequence length 125
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Spliceosome mRNA Splicing - Major Pathway
  mRNA Splicing - Minor Pathway
Sort by:
SF3B4 3 shared pathwaysSpliceosome, mRNA Splicing - Major Pathway, mRNA Splicing - Minor Pathway Related via 3 shared pathways including Spliceosome, mRNA Splicing - Major Pathway. PRPF8 3 shared pathwaysSpliceosome, mRNA Splicing - Major Pathway, mRNA Splicing - Minor Pathway Related via 3 shared pathways including Spliceosome, mRNA Splicing - Major Pathway. TXNL4A 3 shared pathwaysSpliceosome, mRNA Splicing - Major Pathway, mRNA Splicing - Minor Pathway Related via 3 shared pathways including Spliceosome, mRNA Splicing - Major Pathway. SF3B2 3 shared pathwaysSpliceosome, mRNA Splicing - Major Pathway, mRNA Splicing - Minor Pathway Related via 3 shared pathways including Spliceosome, mRNA Splicing - Major Pathway. DDX42 3 shared pathwaysSpliceosome, mRNA Splicing - Major Pathway, mRNA Splicing - Minor Pathway Related via 3 shared pathways including Spliceosome, mRNA Splicing - Major Pathway.
Metabolic syndrome Linked via 2 of 5 related genesSF3B4, SF3B2 Diabetes mellitus type 2 Linked via 2 of 5 related genesSF3B4, SF3B2 Retinitis pigmentosa Linked via 2 of 5 related genesPRPF8, SF3B2 Acrofacial dysostosis Linked via 1 of 5 related genesSF3B4 Congenital hearing disorder Linked via 1 of 5 related genesSF3B4