SDHC (succinate dehydrogenase complex subunit C)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 6391
• Gene name: Succinate dehydrogenase complex subunit C
• Gene symbol: SDHC
• Synonyms (NCBI Gene): CYB560, CYBL, PGL3, PPGL3, QPS1, SDH3
• Chromosome: 1
• Chromosome location: 1q23.3
• Summary: This gene encodes one of four nuclear-encoded subunits that comprise succinate dehydrogenase, also known as mitochondrial complex II, a key enzyme complex of the tricarboxylic acid cycle and aerobic respiratory chains of mitochondria. The encoded protein

SNPs Show/Hide all (30)

SNP ID	Visualize variation	Clinical significance	Consequence
rs200375156	A>G,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign	Missense variant, coding sequence variant, non coding transcript variant
rs201286421	C>T	Pathogenic	Intron variant, coding sequence variant, stop gained, non coding transcript variant
rs587776652	G>A	Pathogenic	Initiator codon variant, missense variant, non coding transcript variant
rs587776653	G>A,C,T	Likely-pathogenic, pathogenic	Splice donor variant, intron variant
rs587778661	C>T	Uncertain-significance, likely-pathogenic, not-provided	Coding sequence variant, non coding transcript variant, missense variant, intron variant
rs748440817	G>A,T	Likely-pathogenic	Splice donor variant
rs755235380	A>G,T	Pathogenic, likely-pathogenic	Initiator codon variant, missense variant, non coding transcript variant
rs756676111	C>T	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs764575966	C>T	Pathogenic	Stop gained, non coding transcript variant, intron variant, coding sequence variant
rs786202080	C>T	Conflicting-interpretations-of-pathogenicity, likely-benign	Synonymous variant, coding sequence variant, intron variant, non coding transcript variant
rs786202200	G>A,T	Likely-pathogenic	Splice acceptor variant, intron variant
rs786203457	A>G	Likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant, intron variant, non coding transcript variant
rs786205146	T>-	Pathogenic, likely-pathogenic	Coding sequence variant, frameshift variant, non coding transcript variant
rs786205147	G>A,T	Likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant, non coding transcript variant
rs794727791	A>G	Conflicting-interpretations-of-pathogenicity, likely-benign	Missense variant, coding sequence variant, synonymous variant, non coding transcript variant
rs867966048	G>A,C	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs876658301	->T	Pathogenic	Coding sequence variant, intron variant, frameshift variant, non coding transcript variant
rs898854295	A>G	Likely-pathogenic, uncertain-significance, pathogenic	Intron variant, coding sequence variant, non coding transcript variant, missense variant
rs981049067	G>A,C	Pathogenic, likely-pathogenic, uncertain-significance	Stop gained, coding sequence variant, non coding transcript variant, intron variant, missense variant
rs1057517818	G>C	Likely-pathogenic	Splice donor variant, intron variant
rs1131691062	A>G	Likely-pathogenic	Intron variant, splice acceptor variant
rs1553260596	->TG	Pathogenic	Non coding transcript variant, coding sequence variant, stop gained
rs1553261757	CAGAC>-	Likely-pathogenic	Intron variant, coding sequence variant, splice acceptor variant, non coding transcript variant
rs1553264218	G>-	Pathogenic	Non coding transcript variant, frameshift variant, coding sequence variant
rs1553265817	TATCATACCTGGAATG>-	Pathogenic	Intron variant, frameshift variant, coding sequence variant, non coding transcript variant
rs1553266474	TGTGGGACCTAGGAAAAGGCCTGAAGATTCCCCAGCTATACCAGTCTGGAGTGGTTGTCCTGGTTCTTACTGTGTTGTCCTCTATGGGGCTGGCAGCCATGTGAA>-	Pathogenic	Inframe indel, non coding transcript variant, coding sequence variant, stop lost, 3 prime UTR variant, terminator codon variant
rs1558164647	G>A	Likely-pathogenic	Intron variant, splice donor variant
rs1558182956	G>-	Likely-pathogenic	Intron variant, coding sequence variant, non coding transcript variant, splice donor variant
rs1571869304	->T	Pathogenic	Coding sequence variant, non coding transcript variant, frameshift variant
rs1571889991	CTTT>-	Pathogenic	Intron variant, coding sequence variant, non coding transcript variant, frameshift variant

miRNA Show/Hide all (317)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025841	hsa-miR-7-5p	Microarray	19073608
MIRT044536	hsa-miR-320a	CLASH	23622248
MIRT040069	hsa-miR-615-3p	CLASH	23622248
MIRT036997	hsa-miR-877-3p	CLASH	23622248
MIRT498304	hsa-miR-8084	PAR-CLIP	22291592
MIRT498303	hsa-miR-9-3p	PAR-CLIP	22291592
MIRT733619	hsa-miR-145-5p	Microarray	34012635
MIRT733620	hsa-miR-185-5p	Microarray	34012635
MIRT498304	hsa-miR-8084	PAR-CLIP	22291592
MIRT498303	hsa-miR-9-3p	PAR-CLIP	22291592
MIRT1331832	hsa-miR-1252	CLIP-seq
MIRT1331833	hsa-miR-1299	CLIP-seq
MIRT1331834	hsa-miR-142-5p	CLIP-seq
MIRT1331835	hsa-miR-3119	CLIP-seq
MIRT1331836	hsa-miR-3133	CLIP-seq
MIRT1331837	hsa-miR-3163	CLIP-seq
MIRT1331838	hsa-miR-3188	CLIP-seq
MIRT1331839	hsa-miR-323-3p	CLIP-seq
MIRT1331840	hsa-miR-3545-3p	CLIP-seq
MIRT1331841	hsa-miR-3662	CLIP-seq
MIRT1331842	hsa-miR-3682-5p	CLIP-seq
MIRT1331843	hsa-miR-3973	CLIP-seq
MIRT1331844	hsa-miR-4266	CLIP-seq
MIRT1331845	hsa-miR-4282	CLIP-seq
MIRT1331846	hsa-miR-4328	CLIP-seq
MIRT1331847	hsa-miR-4422	CLIP-seq
MIRT1331848	hsa-miR-4428	CLIP-seq
MIRT1331849	hsa-miR-4434	CLIP-seq
MIRT1331850	hsa-miR-4476	CLIP-seq
MIRT1331851	hsa-miR-4516	CLIP-seq
MIRT1331852	hsa-miR-4539	CLIP-seq
MIRT1331853	hsa-miR-4668-5p	CLIP-seq
MIRT1331854	hsa-miR-4683	CLIP-seq
MIRT1331855	hsa-miR-4760-3p	CLIP-seq
MIRT1331856	hsa-miR-4782-5p	CLIP-seq
MIRT1331857	hsa-miR-496	CLIP-seq
MIRT1331858	hsa-miR-516b	CLIP-seq
MIRT1331859	hsa-miR-539	CLIP-seq
MIRT1331860	hsa-miR-548a-5p	CLIP-seq
MIRT1331861	hsa-miR-548aa	CLIP-seq
MIRT1331862	hsa-miR-548ab	CLIP-seq
MIRT1331863	hsa-miR-548ak	CLIP-seq
MIRT1331864	hsa-miR-548b-5p	CLIP-seq
MIRT1331865	hsa-miR-548c-5p	CLIP-seq
MIRT1331866	hsa-miR-548d-5p	CLIP-seq
MIRT1331867	hsa-miR-548h	CLIP-seq
MIRT1331868	hsa-miR-548i	CLIP-seq
MIRT1331869	hsa-miR-548j	CLIP-seq
MIRT1331870	hsa-miR-548k	CLIP-seq
MIRT1331871	hsa-miR-548l	CLIP-seq
MIRT1331872	hsa-miR-548w	CLIP-seq
MIRT1331873	hsa-miR-548y	CLIP-seq
MIRT1331874	hsa-miR-559	CLIP-seq
MIRT1331875	hsa-miR-577	CLIP-seq
MIRT1331876	hsa-miR-628-5p	CLIP-seq
MIRT1331877	hsa-miR-875-3p	CLIP-seq
MIRT1331878	hsa-miR-124	CLIP-seq
MIRT1331879	hsa-miR-1290	CLIP-seq
MIRT1331880	hsa-miR-129-5p	CLIP-seq
MIRT1331881	hsa-miR-1301	CLIP-seq
MIRT1331882	hsa-miR-3613-3p	CLIP-seq
MIRT1331883	hsa-miR-3714	CLIP-seq
MIRT1331884	hsa-miR-3910	CLIP-seq
MIRT1331885	hsa-miR-4477b	CLIP-seq
MIRT1331886	hsa-miR-4506	CLIP-seq
MIRT1331887	hsa-miR-450b-5p	CLIP-seq
MIRT1331853	hsa-miR-4668-5p	CLIP-seq
MIRT1331888	hsa-miR-4691-3p	CLIP-seq
MIRT1331889	hsa-miR-495	CLIP-seq
MIRT1331890	hsa-miR-5047	CLIP-seq
MIRT1331891	hsa-miR-506	CLIP-seq
MIRT1331892	hsa-miR-507	CLIP-seq
MIRT1331893	hsa-miR-557	CLIP-seq
MIRT2098052	hsa-miR-1273d	CLIP-seq
MIRT1331879	hsa-miR-1290	CLIP-seq
MIRT2098053	hsa-miR-185	CLIP-seq
MIRT2098054	hsa-miR-3065-3p	CLIP-seq
MIRT2098055	hsa-miR-3123	CLIP-seq
MIRT2098056	hsa-miR-330-3p	CLIP-seq
MIRT2098057	hsa-miR-3692	CLIP-seq
MIRT1331843	hsa-miR-3973	CLIP-seq
MIRT2098058	hsa-miR-4279	CLIP-seq
MIRT2098059	hsa-miR-4306	CLIP-seq
MIRT1331848	hsa-miR-4428	CLIP-seq
MIRT2098060	hsa-miR-4436b-5p	CLIP-seq
MIRT2098061	hsa-miR-4644	CLIP-seq
MIRT1331854	hsa-miR-4683	CLIP-seq
MIRT2098062	hsa-miR-4719	CLIP-seq
MIRT2098063	hsa-miR-4725-5p	CLIP-seq
MIRT2098064	hsa-miR-4802-5p	CLIP-seq
MIRT2098065	hsa-miR-504	CLIP-seq
MIRT2098066	hsa-miR-548m	CLIP-seq
MIRT2098067	hsa-miR-584	CLIP-seq
MIRT2098068	hsa-miR-3647-3p	CLIP-seq
MIRT2322736	hsa-miR-1238	CLIP-seq
MIRT2322737	hsa-miR-1251	CLIP-seq
MIRT2322738	hsa-miR-1256	CLIP-seq
MIRT1331880	hsa-miR-129-5p	CLIP-seq
MIRT1331881	hsa-miR-1301	CLIP-seq
MIRT2322739	hsa-miR-1302	CLIP-seq
MIRT2322740	hsa-miR-141	CLIP-seq
MIRT2322741	hsa-miR-187	CLIP-seq
MIRT2322742	hsa-miR-200a	CLIP-seq
MIRT2322743	hsa-miR-2053	CLIP-seq
MIRT2322744	hsa-miR-219-2-3p	CLIP-seq
MIRT2322745	hsa-miR-2355-3p	CLIP-seq
MIRT2322746	hsa-miR-2682	CLIP-seq
MIRT2322747	hsa-miR-298	CLIP-seq
MIRT2322748	hsa-miR-3064-5p	CLIP-seq
MIRT2098054	hsa-miR-3065-3p	CLIP-seq
MIRT2098055	hsa-miR-3123	CLIP-seq
MIRT2322749	hsa-miR-320b	CLIP-seq
MIRT2322750	hsa-miR-320c	CLIP-seq
MIRT2322751	hsa-miR-320d	CLIP-seq
MIRT2098056	hsa-miR-330-3p	CLIP-seq
MIRT2322752	hsa-miR-34a	CLIP-seq
MIRT2322753	hsa-miR-34c-5p	CLIP-seq
MIRT1331882	hsa-miR-3613-3p	CLIP-seq
MIRT2098068	hsa-miR-3647-3p	CLIP-seq
MIRT2098057	hsa-miR-3692	CLIP-seq
MIRT2322754	hsa-miR-3909	CLIP-seq
MIRT2322755	hsa-miR-4265	CLIP-seq
MIRT2322756	hsa-miR-4287	CLIP-seq
MIRT2322757	hsa-miR-4296	CLIP-seq
MIRT2322758	hsa-miR-4298	CLIP-seq
MIRT2322759	hsa-miR-4322	CLIP-seq
MIRT2322760	hsa-miR-4417	CLIP-seq
MIRT1331848	hsa-miR-4428	CLIP-seq
MIRT2322761	hsa-miR-4429	CLIP-seq
MIRT2322762	hsa-miR-4436b-3p	CLIP-seq
MIRT2098060	hsa-miR-4436b-5p	CLIP-seq
MIRT2322763	hsa-miR-4469	CLIP-seq
MIRT2322764	hsa-miR-4487	CLIP-seq
MIRT2322765	hsa-miR-449a	CLIP-seq
MIRT2322766	hsa-miR-449b	CLIP-seq
MIRT2322767	hsa-miR-449c	CLIP-seq
MIRT2322768	hsa-miR-4503	CLIP-seq
MIRT1331887	hsa-miR-450b-5p	CLIP-seq
MIRT2322769	hsa-miR-4514	CLIP-seq
MIRT1331854	hsa-miR-4683	CLIP-seq
MIRT2322770	hsa-miR-4685-3p	CLIP-seq
MIRT1331888	hsa-miR-4691-3p	CLIP-seq
MIRT2322771	hsa-miR-4692	CLIP-seq
MIRT2098062	hsa-miR-4719	CLIP-seq
MIRT2322772	hsa-miR-4720-5p	CLIP-seq
MIRT2098063	hsa-miR-4725-5p	CLIP-seq
MIRT2322773	hsa-miR-4749-3p	CLIP-seq
MIRT2322774	hsa-miR-4766-5p	CLIP-seq
MIRT2322775	hsa-miR-4775	CLIP-seq
MIRT2322776	hsa-miR-4777-5p	CLIP-seq
MIRT2322777	hsa-miR-4786-3p	CLIP-seq
MIRT2322778	hsa-miR-4799-3p	CLIP-seq
MIRT2322779	hsa-miR-498	CLIP-seq
MIRT2098065	hsa-miR-504	CLIP-seq
MIRT1331890	hsa-miR-5047	CLIP-seq
MIRT1331892	hsa-miR-507	CLIP-seq
MIRT2322780	hsa-miR-518d-5p	CLIP-seq
MIRT2322781	hsa-miR-519b-5p	CLIP-seq
MIRT2322782	hsa-miR-519c-5p	CLIP-seq
MIRT2322783	hsa-miR-520c-5p	CLIP-seq
MIRT2322784	hsa-miR-526a	CLIP-seq
MIRT1331893	hsa-miR-557	CLIP-seq
MIRT2322785	hsa-miR-569	CLIP-seq
MIRT2098067	hsa-miR-584	CLIP-seq
MIRT2322786	hsa-miR-590-3p	CLIP-seq
MIRT2322787	hsa-miR-601	CLIP-seq
MIRT2322788	hsa-miR-642a	CLIP-seq
MIRT2322789	hsa-miR-676	CLIP-seq
MIRT2322790	hsa-miR-892b	CLIP-seq
MIRT1331848	hsa-miR-4428	CLIP-seq
MIRT2322739	hsa-miR-1302	CLIP-seq
MIRT2322758	hsa-miR-4298	CLIP-seq
MIRT2618801	hsa-miR-1229	CLIP-seq
MIRT2322738	hsa-miR-1256	CLIP-seq
MIRT2618802	hsa-miR-1266	CLIP-seq
MIRT2618803	hsa-miR-1295	CLIP-seq
MIRT1331880	hsa-miR-129-5p	CLIP-seq
MIRT1331881	hsa-miR-1301	CLIP-seq
MIRT2322740	hsa-miR-141	CLIP-seq
MIRT2098053	hsa-miR-185	CLIP-seq
MIRT2618804	hsa-miR-1915	CLIP-seq
MIRT2322742	hsa-miR-200a	CLIP-seq
MIRT2322743	hsa-miR-2053	CLIP-seq
MIRT2322744	hsa-miR-219-2-3p	CLIP-seq
MIRT2322745	hsa-miR-2355-3p	CLIP-seq
MIRT2618805	hsa-miR-2355-5p	CLIP-seq
MIRT2322746	hsa-miR-2682	CLIP-seq
MIRT2322747	hsa-miR-298	CLIP-seq
MIRT2098054	hsa-miR-3065-3p	CLIP-seq
MIRT2098055	hsa-miR-3123	CLIP-seq
MIRT2618806	hsa-miR-3185	CLIP-seq
MIRT2322749	hsa-miR-320b	CLIP-seq
MIRT2322750	hsa-miR-320c	CLIP-seq
MIRT2322751	hsa-miR-320d	CLIP-seq
MIRT2098056	hsa-miR-330-3p	CLIP-seq
MIRT2322752	hsa-miR-34a	CLIP-seq
MIRT2322753	hsa-miR-34c-5p	CLIP-seq
MIRT1331882	hsa-miR-3613-3p	CLIP-seq
MIRT2618807	hsa-miR-3664-3p	CLIP-seq
MIRT2098057	hsa-miR-3692	CLIP-seq
MIRT2618808	hsa-miR-378g	CLIP-seq
MIRT2322755	hsa-miR-4265	CLIP-seq
MIRT2322757	hsa-miR-4296	CLIP-seq
MIRT2098059	hsa-miR-4306	CLIP-seq
MIRT2322759	hsa-miR-4322	CLIP-seq
MIRT2322760	hsa-miR-4417	CLIP-seq
MIRT2322761	hsa-miR-4429	CLIP-seq
MIRT2322762	hsa-miR-4436b-3p	CLIP-seq
MIRT2098060	hsa-miR-4436b-5p	CLIP-seq
MIRT2618809	hsa-miR-4437	CLIP-seq
MIRT2322764	hsa-miR-4487	CLIP-seq
MIRT2322765	hsa-miR-449a	CLIP-seq
MIRT2322766	hsa-miR-449b	CLIP-seq
MIRT2322767	hsa-miR-449c	CLIP-seq
MIRT2322768	hsa-miR-4503	CLIP-seq
MIRT1331887	hsa-miR-450b-5p	CLIP-seq
MIRT2322769	hsa-miR-4514	CLIP-seq
MIRT2618810	hsa-miR-4518	CLIP-seq
MIRT2098061	hsa-miR-4644	CLIP-seq
MIRT1331853	hsa-miR-4668-5p	CLIP-seq
MIRT2618811	hsa-miR-4674	CLIP-seq
MIRT2618812	hsa-miR-4685-5p	CLIP-seq
MIRT1331888	hsa-miR-4691-3p	CLIP-seq
MIRT2322771	hsa-miR-4692	CLIP-seq
MIRT2618813	hsa-miR-4694-5p	CLIP-seq
MIRT2618814	hsa-miR-4709-3p	CLIP-seq
MIRT2098062	hsa-miR-4719	CLIP-seq
MIRT2322772	hsa-miR-4720-5p	CLIP-seq
MIRT2098063	hsa-miR-4725-5p	CLIP-seq
MIRT2322777	hsa-miR-4786-3p	CLIP-seq
MIRT2322778	hsa-miR-4799-3p	CLIP-seq
MIRT2098064	hsa-miR-4802-5p	CLIP-seq
MIRT2098065	hsa-miR-504	CLIP-seq
MIRT1331890	hsa-miR-5047	CLIP-seq
MIRT1331892	hsa-miR-507	CLIP-seq
MIRT1331893	hsa-miR-557	CLIP-seq
MIRT2322785	hsa-miR-569	CLIP-seq
MIRT2098067	hsa-miR-584	CLIP-seq
MIRT2618815	hsa-miR-645	CLIP-seq
MIRT2618816	hsa-miR-661	CLIP-seq
MIRT2322789	hsa-miR-676	CLIP-seq
MIRT2618817	hsa-miR-873	CLIP-seq
MIRT2618818	hsa-miR-892a	CLIP-seq
MIRT2618819	hsa-miR-941	CLIP-seq
MIRT2618801	hsa-miR-1229	CLIP-seq
MIRT2322738	hsa-miR-1256	CLIP-seq
MIRT2618802	hsa-miR-1266	CLIP-seq
MIRT2618803	hsa-miR-1295	CLIP-seq
MIRT1331880	hsa-miR-129-5p	CLIP-seq
MIRT1331881	hsa-miR-1301	CLIP-seq
MIRT2322740	hsa-miR-141	CLIP-seq
MIRT2098053	hsa-miR-185	CLIP-seq
MIRT2618804	hsa-miR-1915	CLIP-seq
MIRT2322742	hsa-miR-200a	CLIP-seq
MIRT2322743	hsa-miR-2053	CLIP-seq
MIRT2322744	hsa-miR-219-2-3p	CLIP-seq
MIRT2322745	hsa-miR-2355-3p	CLIP-seq
MIRT2618805	hsa-miR-2355-5p	CLIP-seq
MIRT2322746	hsa-miR-2682	CLIP-seq
MIRT2322747	hsa-miR-298	CLIP-seq
MIRT2098054	hsa-miR-3065-3p	CLIP-seq
MIRT2098055	hsa-miR-3123	CLIP-seq
MIRT2618806	hsa-miR-3185	CLIP-seq
MIRT2322749	hsa-miR-320b	CLIP-seq
MIRT2322750	hsa-miR-320c	CLIP-seq
MIRT2322751	hsa-miR-320d	CLIP-seq
MIRT2098056	hsa-miR-330-3p	CLIP-seq
MIRT2322752	hsa-miR-34a	CLIP-seq
MIRT2322753	hsa-miR-34c-5p	CLIP-seq
MIRT1331882	hsa-miR-3613-3p	CLIP-seq
MIRT2618807	hsa-miR-3664-3p	CLIP-seq
MIRT2098057	hsa-miR-3692	CLIP-seq
MIRT2618808	hsa-miR-378g	CLIP-seq
MIRT2322755	hsa-miR-4265	CLIP-seq
MIRT2322757	hsa-miR-4296	CLIP-seq
MIRT2098059	hsa-miR-4306	CLIP-seq
MIRT2322759	hsa-miR-4322	CLIP-seq
MIRT2322760	hsa-miR-4417	CLIP-seq
MIRT2322761	hsa-miR-4429	CLIP-seq
MIRT2322762	hsa-miR-4436b-3p	CLIP-seq
MIRT2098060	hsa-miR-4436b-5p	CLIP-seq
MIRT2618809	hsa-miR-4437	CLIP-seq
MIRT2322764	hsa-miR-4487	CLIP-seq
MIRT2322765	hsa-miR-449a	CLIP-seq
MIRT2322766	hsa-miR-449b	CLIP-seq
MIRT2322767	hsa-miR-449c	CLIP-seq
MIRT2322768	hsa-miR-4503	CLIP-seq
MIRT1331887	hsa-miR-450b-5p	CLIP-seq
MIRT2322769	hsa-miR-4514	CLIP-seq
MIRT2618810	hsa-miR-4518	CLIP-seq
MIRT2098061	hsa-miR-4644	CLIP-seq
MIRT1331853	hsa-miR-4668-5p	CLIP-seq
MIRT2618811	hsa-miR-4674	CLIP-seq
MIRT2618812	hsa-miR-4685-5p	CLIP-seq
MIRT1331888	hsa-miR-4691-3p	CLIP-seq
MIRT2322771	hsa-miR-4692	CLIP-seq
MIRT2618813	hsa-miR-4694-5p	CLIP-seq
MIRT2618814	hsa-miR-4709-3p	CLIP-seq
MIRT2098062	hsa-miR-4719	CLIP-seq
MIRT2322772	hsa-miR-4720-5p	CLIP-seq
MIRT2098063	hsa-miR-4725-5p	CLIP-seq
MIRT2322777	hsa-miR-4786-3p	CLIP-seq
MIRT2322778	hsa-miR-4799-3p	CLIP-seq
MIRT2098064	hsa-miR-4802-5p	CLIP-seq
MIRT2098065	hsa-miR-504	CLIP-seq
MIRT1331890	hsa-miR-5047	CLIP-seq
MIRT1331892	hsa-miR-507	CLIP-seq
MIRT1331893	hsa-miR-557	CLIP-seq
MIRT2322785	hsa-miR-569	CLIP-seq
MIRT2098067	hsa-miR-584	CLIP-seq
MIRT2322787	hsa-miR-601	CLIP-seq
MIRT2618815	hsa-miR-645	CLIP-seq
MIRT2618816	hsa-miR-661	CLIP-seq
MIRT2322789	hsa-miR-676	CLIP-seq
MIRT2618817	hsa-miR-873	CLIP-seq
MIRT2618818	hsa-miR-892a	CLIP-seq
MIRT2618819	hsa-miR-941	CLIP-seq

Gene ontology (GO) Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	2302193
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	ISS
GO:0005743	Component	Mitochondrial inner membrane	NAS	30030361
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006099	Process	Tricarboxylic acid cycle	IEA
GO:0006099	Process	Tricarboxylic acid cycle	NAS	30030361
GO:0006099	Process	Tricarboxylic acid cycle	TAS	9533030
GO:0006121	Process	Mitochondrial electron transport, succinate to ubiquinone	IBA
GO:0006121	Process	Mitochondrial electron transport, succinate to ubiquinone	NAS	30030361
GO:0009055	Function	Electron transfer activity	IEA
GO:0009060	Process	Aerobic respiration	TAS	9533030
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9533030
GO:0020037	Function	Heme binding	ISS
GO:0042776	Process	Proton motive force-driven mitochondrial ATP synthesis	NAS	30030361
GO:0045273	Component	Respiratory chain complex II (succinate dehydrogenase)	IBA
GO:0045273	Component	Respiratory chain complex II (succinate dehydrogenase)	IDA	37098072
GO:0045273	Component	Respiratory chain complex II (succinate dehydrogenase)	ISS
GO:0045273	Component	Respiratory chain complex II (succinate dehydrogenase)	TAS	9533030
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 602413
• HGNC: 10682
• e!Ensembl: ENSG00000143252

Protein

• UniProt ID: Q99643
• Protein name: Succinate dehydrogenase cytochrome b560 subunit, mitochondrial (Integral membrane protein CII-3) (Malate dehydrogenase [quinone] cytochrome b560 subunit) (QPs-1) (QPs1) (Succinate dehydrogenase complex subunit C) (Succinate-ubiquinone oxidoreductase cytoc
• Protein function: Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q) (PubMed:9533030). SD
• PDB: 8GS8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01127	Sdh_cyt	47 → 166	Succinate dehydrogenase/Fumarate reductase transmembrane subunit	Family

• Sequence:

  MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYS
  WSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYLELVKSLCLGPALIHTAKFAL
  VFPLMYHTWNGIRHLMWDLGKGLKIPQLYQSGVVVLVLTVLSSMGLAAM

• Sequence length: 169

Pathways

KEGG Pathway	Reactome Pathway
Citrate cycle (TCA cycle)	Citric acid cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Carbon metabolism
Thermogenesis
Non-alcoholic fatty liver disease
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Huntington disease
Prion disease
Pathways of neurodegeneration - multiple diseases
Chemical carcinogenesis - reactive oxygen species
Diabetic cardiomyopathy

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal Show/Hide Causal Diseases (9)
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Carney triad	Pathogenic; Likely pathogenic	rs786205146, rs786205147, rs587776653	RCV000170331 RCV000170332 RCV000170333	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Carney-Stratakis syndrome	Pathogenic; Likely pathogenic	rs764575966, rs587776653, rs898854295, rs201286421, rs756676111	RCV001329019 RCV000007666 RCV005398713 RCV004819210 RCV004796320	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Gastrointestinal stromal tumor	Likely pathogenic; Pathogenic	rs1249046874, rs2102307803, rs2102370242, rs1483039185, rs1363265634, rs1057517818, rs587778661, rs2102336244, rs2102271857, rs2102307538, rs2526364684, rs786202200, rs786203457, rs764575966, rs786205147, rs2526332292, rs2526445197, rs2526536278, rs755235380, rs587776652, rs587776653, rs1571851717, rs1670517782, rs1553261768, rs2526364876, rs2526365751, rs1571869120, rs778582853, rs1131691062, rs898854295, rs981049067, rs1553265817, rs201286421, rs1553264218, rs1553260596, rs1558182956, rs756676111, rs1571869304, rs1558164647, rs1671145065, rs1671684409, rs1672284298, rs1485675090, rs1672291512, rs1671157149, rs1670921815, rs1671156558, rs1672294906	RCV001378182 RCV001385231 RCV001380966 RCV001384853 RCV002028731 RCV001975845 RCV000641913 RCV001953500 RCV002044863 RCV003775007 RCV005227623 RCV005222790 RCV000641906 RCV000232178 RCV000688261 RCV002797062 RCV002881906 RCV002899357 RCV002933132 RCV000812224 RCV000641917 RCV000023194 RCV003777290 RCV003800158 RCV003801879 RCV003802140 RCV003813266 RCV003810540 RCV005220918 RCV001047084 RCV000791400 RCV000462244 RCV001240954 RCV000551177 RCV001380749 RCV000641918 RCV001386659 RCV000627763 RCV000641911 RCV000641907 RCV003767891 RCV000691372 RCV000809572 RCV000809817 RCV001382560 RCV001221046 RCV001064681 RCV001055954 RCV001058295 RCV001036663 RCV001217901 RCV001202377 RCV001233063 RCV001244070 RCV001232924 RCV001243668 RCV001879958	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Hereditary cancer-predisposing syndrome	Pathogenic; Likely pathogenic	rs2102370242, rs1483039185, rs1363265634, rs587778661, rs2102271857, rs2526572703, rs2526364684, rs786202200, rs786203457, rs764575966, rs2526364101, rs748440817, rs2102370188, rs786205146, rs786205147, rs587776653, rs876658301, rs1558164647, rs1571869120, rs1057517818, rs755235380, rs778582853, rs1131691062, rs898854295, rs981049067, rs867966048, rs1553265817, rs201286421, rs756676111, rs1571869304, rs1571889991, rs1485675090, rs1672294906	RCV003375274 RCV005271228 RCV002407277 RCV000492504 RCV004656677 RCV002339996 RCV002342914 RCV000164903 RCV000166772 RCV000162467 RCV002376670 RCV002450329 RCV002459803 RCV000492519 RCV000564191 RCV000574152 RCV005480316 RCV000215996 RCV004246162 RCV004508382 RCV000492312 RCV000492170 RCV002429493 RCV000492770 RCV000492617 RCV000492239 RCV000492714 RCV000574696 RCV000565535 RCV000569757 RCV000128874 RCV003380656 RCV004669129 RCV002424897 RCV001015229 RCV001015731 RCV001026732 RCV001015445 RCV002354978 RCV004671305	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Hereditary pheochromocytoma and paraganglioma	Likely pathogenic; Pathogenic	rs1249046874, rs587778661, rs786203457, rs764575966, rs587776653, rs2102370242, rs1057517818, rs778582853, rs898854295, rs981049067, rs1553266474, rs1553261757, rs201286421, rs786202200	RCV004803676 RCV000826184 RCV003995530 RCV000505285 RCV003996080 RCV000505371 RCV003404850 RCV003323526 RCV004000756 RCV000505370 RCV004802098 RCV000505297 RCV000612576 RCV000505325 RCV004802320	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Inherited phaeochromocytoma and paraganglioma excluding NF1	Likely pathogenic; Pathogenic	rs786203457, rs898854295, rs201286421	RCV005865260 RCV005865324 RCV005865209	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Pheochromocytoma/paraganglioma syndrome 3	Likely pathogenic; Pathogenic	rs1249046874, rs2102307803, rs2102370242, rs1483039185, rs1363265634, rs1057517818, rs587778661, rs2102336244, rs2102271857, rs2102307538, rs2526364684, rs786202200, rs786203457, rs764575966, rs2526364101, rs786205147, rs2526332292, rs2526445197, rs2526536278, rs755235380, rs587776652, rs587776653, rs1558164647, rs758528026, rs2102384864, rs2526364384, rs1571851717, rs1670517782, rs1553261768, rs2526364876, rs2526365751, rs2526535535, rs1671685956, rs1571869120, rs2526364668, rs778582853, rs1131691062, rs898854295, rs981049067, rs1553265817, rs201286421, rs1553264218, rs1553260596, rs1558182956, rs756676111, rs1571869304, rs1671145065, rs1671684409, rs1672284298, rs1485675090, rs1672291512, rs1671157149, rs1670921815, rs1671156558, rs1672294906	RCV001378182 RCV001385231 RCV001380966 RCV001384853 RCV002028731 RCV001975845 RCV000641913 RCV001953500 RCV002044863 RCV003775007 RCV003316865 RCV005222790 RCV000641906 RCV000232178 RCV005248682 RCV000688261 RCV002797062 RCV002881906 RCV002899357 RCV002933132 RCV000007663 RCV000007664 RCV001201884 RCV003149093 RCV003149096 RCV003316923 RCV003316970 RCV003316997 RCV003800158 RCV003801879 RCV003802140 RCV003813266 RCV003810540 RCV004442524 RCV004442587 RCV005220918 RCV004589328 RCV001047084 RCV000467345 RCV000462244 RCV001240954 RCV000551177 RCV001380749 RCV000641918 RCV001386659 RCV000034695 RCV000641911 RCV000641907 RCV003767891 RCV000691372 RCV000809572 RCV000809817 RCV001382560 RCV001221046 RCV001064681 RCV001055954 RCV001058295 RCV001036663 RCV001217901 RCV001202377 RCV001233063 RCV001244070 RCV001232924 RCV001243668 RCV001256199	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Rhabdomyosarcoma	Likely pathogenic; Pathogenic	rs1672294906	RCV001257556	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SDHC-related disorder	Likely pathogenic; Pathogenic	rs898854295, rs201286421	RCV003419827 RCV004751234	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (19)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
CHARCOT-MARIE-TOOTH DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHARCOT-MARIE-TOOTH DISEASE, DOMINANT INTERMEDIATE D	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHARCOT-MARIE-TOOTH DISEASE, TYPE 2I	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COWDEN DISEASE	—	GWAS catalog	21979946	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cowden syndrome	Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar Orphanet	21979946	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
GASTROINTESTINAL STROMAL TUMORS	—	CTD	31636198	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY MOTOR AND SENSORY NEUROPATHY TYPE I	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
hereditary pheochromocytoma-paraganglioma	—	ClinGen	ClinGen report	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of breast	Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL DISEASES	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARAGANGLIOMA AND GASTRIC STROMAL SARCOMA	—	HPO	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARAGANGLIOMA AND GASTRIC STROMAL SARCOMA SYNDROME	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARAGANGLIOMAS 3	—	CTD, Disgenet CTD, Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pheochromocytoma	Uncertain significance; Conflicting classifications of pathogenicity; Likely benign; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (181)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenoma	Adenoma	BEFREE	26652933		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	19522821		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	14674304, 14974914, 15883704, 15883706, 16249420, 16405730, 17102086, 17557926, 19233206, 19368708, 19522821, 19546167, 20236688, 20484225, 20980436, 21455202, 22566194, 23175444, 23512077, 24466223, 24625421, 25004247, 25800244, 28432847, 30421319		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	15365216		★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33560870	Associate	★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cafe au lait spots, multiple	Cafe-au-lait spot	HPO_DG			★☆☆☆☆ Found in Text Mining only
Capillary hemangioma of retina	Capillary Hemangioma Of Retina	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24859990	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	32156290	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25894340, 36308411	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	32156290	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of Endocrine Gland	Endocrine Gland cancer	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27723786		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23083876, 24625421, 34014604, 34558728, 36455002	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney complex	Pubtator	19522821	Associate	★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney Complex	BEFREE	25540324		★☆☆☆☆ Found in Text Mining only
Carney Triad	Carney Triad	BEFREE	19522821, 24859990, 25540324, 25808178, 26173966, 26652933, 28739378, 29239034		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Carney Triad	Carney complex	Pubtator	24859990, 25540324	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Carney Triad	Carney Triad	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Carney-Stratakis syndrome	Carney-Stratakis Syndrome	Orphanet			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Carotid Body Paraganglioma	Carotid Body Paraganglioma	BEFREE	16249420		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	12611464		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	22351710		★☆☆☆☆ Found in Text Mining only
Coffin-Siris syndrome	Coffin-Siris Syndrome	BEFREE	25808178, 28739378		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36949947	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Color Blindness, Blue	Color blindness	BEFREE	22351710		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26377099		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26377099	Associate	★☆☆☆☆ Found in Text Mining only
Conductive hearing loss	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Conjunctival hamartoma	Conjunctival hamartoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18728283, 22351710, 25800244, 26476567		★☆☆☆☆ Found in Text Mining only
Cowden syndrome	Cowden Syndrome	Orphanet			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cranial nerve compression	Cranial nerve compression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cranial nerve palsies	Cranial Nerve Paralysis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	30301441		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Enlarged polycystic ovaries	Enlarged polycystic ovaries	HPO_DG			★☆☆☆☆ Found in Text Mining only
Episodic paroxysmal anxiety	Episodic paroxysmal anxiety	HPO_DG			★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	HPO_DG			★☆☆☆☆ Found in Text Mining only
Extra-Adrenal Paraganglioma	Extra-Adrenal Paraganglioma	BEFREE	22293219		★☆☆☆☆ Found in Text Mining only
Extra-Adrenal Paraganglioma	Extra-Adrenal Paraganglioma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Fibrous skin tumor of tuberous sclerosis	Adenoma sebaceum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ganglioneuroma	Ganglioneuroma	BEFREE	26173966		★☆☆☆☆ Found in Text Mining only
Ganglioneuroma	Ganglioneuroma	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Sarcoma	Gastrointestinal stromal tumor	ORPHANET_DG	21173220		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Sarcoma	Gastrointestinal stromal tumor	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Gastrointestinal stromal tumor	Gastrointestinal stromal tumor	Orphanet			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	CLINVAR_DG	11062460, 12658451, 15342702, 16249420, 17667967, 17898811, 19351833, 19454582, 21106325, 22351710, 22517554, 22868853, 23083876, 23282968, 23666964, 24102379, 24402737, 24423348, 24523625, 24758179, 24781345, 27279923, 27700540		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	17535989, 19522821, 19522824, 21173220, 23174939, 25540324, 25808178, 26415883, 26652933, 28768491, 29239034, 30301441, 31308404		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	LHGDN	17804857		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	19522821, 21173220, 22955521, 23109135, 23174939, 23612575, 23743927, 24625421, 25540324, 26415883, 31308404, 34558728	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	ORPHANET_DG	21173220		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	GENOMICS_ENGLAND_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	15365216		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glomus Jugulare Tumor	Glomus Jugulare Tumor	BEFREE	17102086		★☆☆☆☆ Found in Text Mining only
Glomus Jugulare Tumor	Glomus Jugulare Tumor	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	ORPHANET_DG	21979946		★☆☆☆☆ Found in Text Mining only
Hamartomatous polyposis	Hamartomatous polyposis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	16405730, 19906784, 21106325, 21224366, 27700540, 34558728	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	BEFREE	19343621		★☆☆☆☆ Found in Text Mining only
Hemangioma, Cavernous	Hemangioma, Cavernous	HPO_DG			★☆☆☆☆ Found in Text Mining only
hereditary paraganglioma	Hereditary Paraganglioma	BEFREE	10541590, 11404820, 15479192, 15883704, 15905695, 16001332, 16405730, 17487275, 17973943, 18978332, 19368708, 20111059, 24758179, 24781345		★☆☆☆☆ Found in Text Mining only
Hereditary Paraganglioma-Pheochromocytoma Syndrome	Hereditary Paraganglioma-Pheochromocytoma Syndromes	CLINGEN_DG	11062460, 11426453, 12658451, 15342702, 16249420, 16405730, 21784903, 23175444		★☆☆☆☆ Found in Text Mining only
Hereditary Paraganglioma-Pheochromocytoma Syndrome	Hereditary Paraganglioma-Pheochromocytoma Syndromes	CLINVAR_DG	17667967, 17898811, 19351833, 19454582, 21106325, 22703879, 22868853, 23083876, 23175444, 23666964, 24102379, 24423348, 24523625, 24728327, 24758179, 24781345, 25024072, 25394176, 27279923, 27700540		★☆☆☆☆ Found in Text Mining only
Hereditary Paraganglioma-Pheochromocytoma Syndrome	Hereditary Paraganglioma-Pheochromocytoma Syndromes	BEFREE	29501297		★☆☆☆☆ Found in Text Mining only
Hereditary Paraganglioma-Pheochromocytoma Syndrome	Hereditary Paraganglioma-Pheochromocytoma Syndromes	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Hereditary pheochromocytoma-paraganglioma	Hereditary Pheochromocytoma-Paraganglioma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercalcemia	Hypercalcemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	BEFREE	26492543		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	17557926	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension associated with pheochromocytoma	Hypertension associated with pheochromocytoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	17557926		★☆☆☆☆ Found in Text Mining only
Hypertensive Retinopathy	Hypertensive Retinopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34021238	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intestinal Obstruction	Intestinal Obstruction	HPO_DG			★☆☆☆☆ Found in Text Mining only
Keratoderma, Palmoplantar	Palmoplantar keratoderma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36245043	Associate	★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	14991929, 24726886, 31278950		★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Macroglossia	Macroglossia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27723786		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14732878		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17250422		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16249420, 17250422, 22125623, 24423348, 24758179, 25014332, 25540324		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	16322339		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	HPO_DG			★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mitochondrial Complex II Deficiency	Mitochondrial complex deficiency	Pubtator	27011036, 31308404	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	GENOMICS_ENGLAND_DG	27604308		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Endocrine Neoplasia	Multiple Endocrine Neoplasia	BEFREE	19522821		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	19522821		★☆☆☆☆ Found in Text Mining only
Multiple endocrine neoplasia Type 2	Multiple Endocrine Neoplasia	BEFREE	15531530		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 2a	Multiple Endocrine Neoplasia	BEFREE	15531530		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	32144272	Associate	★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neoplasm of small intestine	Intestinal Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12509798, 16327764, 17487275, 19522823, 20236688, 20626878, 22030282, 22955521, 23512077, 23743927, 24758179, 24859990, 25540324, 27011036		★☆☆☆☆ Found in Text Mining only
Neoplastic Syndromes, Hereditary	Hereditary Cancer Syndrome	CLINVAR_DG	12658451, 15989954, 16249420, 17667967, 17898811, 19332149, 19351833, 19454582, 21106325, 22703879, 22868853, 23083876, 23162105, 23175444, 23282968, 23666964, 24096523, 24102379, 24150194, 24423348, 24625421, 24728327, 24758179, 24781345, 24886695, 25025441, 25394176, 25494863, 26173966, 26492543, 27279923, 27700540, 28412079, 28819017, 29386252		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15337319		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	20592014		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	28432847		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	20236688, 28432847		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12509279, 23670238		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29107296, 30782949	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	21357617		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33560870	Associate	★☆☆☆☆ Found in Text Mining only
Panic Attacks	Panic Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	10541590, 11062460, 12351569, 12658451, 14674304, 14974914, 15531530, 15883706, 16249420, 16322339, 16405730, 17102079, 17557926, 18826997, 18978332, 19233206, 19522823, 19546167, 20236688, 20484225, 20498024, 20592014, 20980436, 21082267, 21173220, 21455202, 21784903, 22293219, 22351710, 22907877, 23175444, 23282968, 23512077, 24367056, 24423348, 24466223, 24758179, 25004247, 25014332, 26067997, 26162468, 26492543, 26652933, 27485256, 27634942, 27700540, 28179334, 28431994, 29126304, 29239034, 29878124, 30421319, 31104306		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	LHGDN	11897817, 12658451, 15342702, 16405730, 17804857		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	Pubtator	11897817, 16080474, 16405730, 17557926, 18826997, 19269919, 19522821, 19576851, 20418362, 20505258, 20890271, 20980436, 21106325, 21173220, 21455202, 22703879, 23174939, 23282968, 23512077, 24466223, 24758179, 27700540, 28122379, 29386252, 29878124, 34558728	Associate	★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	HPO_DG			★☆☆☆☆ Found in Text Mining only
PARAGANGLIOMA AND GASTRIC STROMAL SARCOMA	Paraganglioma and gastric stromal sarcoma	ORPHANET_DG	17667967		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARAGANGLIOMA AND GASTRIC STROMAL SARCOMA	Paraganglioma and gastric stromal sarcoma	BEFREE	19522821, 23282968		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARAGANGLIOMA AND GASTRIC STROMAL SARCOMA	Paraganglioma and gastric stromal sarcoma	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARAGANGLIOMA AND GASTRIC STROMAL SARCOMA	Paraganglioma and gastric stromal sarcoma	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paraganglioma of head and neck	Paraganglioma of head and neck	BEFREE	14974914, 16405730, 17102086, 19906784, 21224366		★☆☆☆☆ Found in Text Mining only
Paraganglioma of head and neck	Paraganglioma of head and neck	HPO_DG			★☆☆☆☆ Found in Text Mining only
PARAGANGLIOMAS 3	Paraganglioma	CLINVAR_DG	11062460, 12658451, 15342702, 16249420, 17667967, 17898811, 19351833, 19454582, 21106325, 22351710, 22517554, 22868853, 23083876, 23282968, 23666964, 24102379, 24402737, 24423348, 24523625, 24758179, 24781345, 27279923, 27700540		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARAGANGLIOMAS 3	Paraganglioma	BEFREE	17557926, 21742608, 24758179		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paragangliomas 3	Paraganglioma	Pubtator	17557926, 19269919, 20890271, 24758179, 29878124	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARAGANGLIOMAS 3	Paraganglioma	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARAGANGLIOMAS 4	Paraganglioma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	14674304, 14974914, 15883704, 15883706, 16249420, 16405730, 17102086, 17557926, 19233206, 19368708, 19522821, 19546167, 20236688, 20484225, 21455202, 22566194, 23175444, 24625421, 25800244		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pheochromocytoma	Pheochromocytoma	Pubtator	16098460, 16288654, 16405730, 19368708, 20484225, 20505258, 20890271, 20980436, 21455202, 22573489, 23174939, 23512077, 24466223, 24625421, 26173966, 28099933	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pheochromocytoma	Pheochromocytoma	CGI_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pheochromocytoma, Extra-Adrenal	Extra-Adrenal Pheochromocytoma	BEFREE	16249420		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma, Extra-Adrenal	Extra-Adrenal Pheochromocytoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	25494863	Associate	★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	HPO_DG			★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14732878		★☆☆☆☆ Found in Text Mining only
Pulmonary chondroma	Pulmonary chondroma	BEFREE	29239034		★☆☆☆☆ Found in Text Mining only
Pulmonary chondroma	Pulmonary chondroma	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Pulsatile Tinnitus	Pulsatile Tinnitus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Raynaud Phenomenon	Raynaud Phenomenon	BEFREE	28431994		★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	22351710		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18728283, 22351710, 25800244, 26476567		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sinus Tachycardia	Sinus Tachycardia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	15665468		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 2	Spinocerebellar Ataxia	BEFREE	9918835		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17250422		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	17440718		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	25694510		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	HPO_DG			★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	37899663	Associate	★☆☆☆☆ Found in Text Mining only
Vocal Cord Paralysis	Vocal Cord Paralysis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	14739490, 22351710		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

SDHB 8 shared diseasesCarney complex, Carney-stratakis syndrome, Cowden disease, Gastrointestinal stromal tumor, Mitochondrial disease, Paraganglioma, Pheochromocytoma/paraganglioma syndrome, hereditary pheochromocytoma-paraganglioma 10 shared pathwaysCitrate cycle (TCA cycle), Oxidative phosphorylation, Carbon metabolism, Thermogenesis, Non-alcoholic fatty liver disease, Parkinson disease, Prion disease, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy, Citric acid cycle (TCA cycle) 18 shared evidence sourcesDisgenet (Carney complex), Orphanet (Carney complex), Orphanet (Carney-stratakis syndrome), CTD (Carney-stratakis syndrome), ClinVar (Carney-stratakis syndrome), GWAS catalog (Cowden disease), Orphanet (Cowden disease), ClinVar (Gastrointestinal stromal tumor), HPO (Gastrointestinal stromal tumor), Orphanet (Gastrointestinal stromal tumor), CTD (Gastrointestinal stromal tumor), Disgenet (Mitochondrial disease) +6 more Related via 10 shared pathways including Citrate cycle (TCA cycle), Oxidative phosphorylation — evidence mostly Orphanet. SDHD 6 shared diseasesCarney-stratakis syndrome, Cowden disease, Mitochondrial disease, Paraganglioma, Pheochromocytoma/paraganglioma syndrome, hereditary pheochromocytoma-paraganglioma 10 shared pathwaysCitrate cycle (TCA cycle), Oxidative phosphorylation, Carbon metabolism, Thermogenesis, Non-alcoholic fatty liver disease, Parkinson disease, Prion disease, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy, Citric acid cycle (TCA cycle) 12 shared evidence sourcesOrphanet (Carney-stratakis syndrome), CTD (Carney-stratakis syndrome), ClinVar (Carney-stratakis syndrome), GenCC (Carney-stratakis syndrome), Orphanet (Cowden disease), Disgenet (Mitochondrial disease), CTD (Paraganglioma), HPO (Paraganglioma), Disgenet (Paraganglioma), ClinVar (Pheochromocytoma/paraganglioma syndrome), HPO (Pheochromocytoma/paraganglioma syndrome), ClinGen (hereditary pheochromocytoma-paraganglioma) Related via 10 shared pathways including Citrate cycle (TCA cycle), Oxidative phosphorylation — evidence mostly Orphanet. SDHA 7 shared diseasesCarney complex, Carney-stratakis syndrome, Gastrointestinal stromal tumor, Mitochondrial disease, Paraganglioma, Pheochromocytoma/paraganglioma syndrome, hereditary pheochromocytoma-paraganglioma 10 shared pathwaysCitrate cycle (TCA cycle), Oxidative phosphorylation, Carbon metabolism, Thermogenesis, Non-alcoholic fatty liver disease, Parkinson disease, Prion disease, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy, Citric acid cycle (TCA cycle) 8 shared evidence sourcesDisgenet (Carney complex), Orphanet (Carney complex), Orphanet (Carney-stratakis syndrome), Orphanet (Gastrointestinal stromal tumor), Disgenet (Paraganglioma), ClinVar (Pheochromocytoma/paraganglioma syndrome), HPO (Pheochromocytoma/paraganglioma syndrome), ClinGen (hereditary pheochromocytoma-paraganglioma) Related via 10 shared pathways including Citrate cycle (TCA cycle), Oxidative phosphorylation — evidence mostly Orphanet. COX6A1 3 shared diseasesCharcot-marie-tooth disease, Hereditary motor and sensory neuropathies, Mitochondrial disease 7 shared pathwaysOxidative phosphorylation, Thermogenesis, Non-alcoholic fatty liver disease, Parkinson disease, Prion disease, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy 3 shared evidence sourcesDisgenet (Charcot-marie-tooth disease), Disgenet (Hereditary motor and sensory neuropathies), Disgenet (Mitochondrial disease) Related via 7 shared pathways including Oxidative phosphorylation, Thermogenesis — evidence mostly Disgenet. SDHAF2 3 shared diseasesParaganglioma, Pheochromocytoma/paraganglioma syndrome, hereditary pheochromocytoma-paraganglioma 6 shared evidence sourcesCTD (Paraganglioma), Disgenet (Paraganglioma), ClinVar (Pheochromocytoma/paraganglioma syndrome), HPO (Pheochromocytoma/paraganglioma syndrome), Disgenet (Pheochromocytoma/paraganglioma syndrome), ClinGen (hereditary pheochromocytoma-paraganglioma) Related via 3 shared diseases including Paraganglioma, Pheochromocytoma/paraganglioma syndrome — evidence mostly Disgenet.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
SDHB	8	["Carney complex","Carney-stratakis syndrome","Cowden disease","Gastrointestinal stromal tumor","Mitochondrial disease","Paraganglioma","Pheochromocytoma\/paraganglioma syndrome","hereditary pheochromocytoma-paraganglioma"]	10	["Citrate cycle (TCA cycle)","Oxidative phosphorylation","Carbon metabolism","Thermogenesis","Non-alcoholic fatty liver disease","Parkinson disease","Prion disease","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy","Citric acid cycle (TCA cycle)"]	18	["Disgenet (Carney complex)","Orphanet (Carney complex)","Orphanet (Carney-stratakis syndrome)","CTD (Carney-stratakis syndrome)","ClinVar (Carney-stratakis syndrome)","GWAS catalog (Cowden disease)","Orphanet (Cowden disease)","ClinVar (Gastrointestinal stromal tumor)","HPO (Gastrointestinal stromal tumor)","Orphanet (Gastrointestinal stromal tumor)","CTD (Gastrointestinal stromal tumor)","Disgenet (Mitochondrial disease)"]
SDHD	6	["Carney-stratakis syndrome","Cowden disease","Mitochondrial disease","Paraganglioma","Pheochromocytoma\/paraganglioma syndrome","hereditary pheochromocytoma-paraganglioma"]	10	["Citrate cycle (TCA cycle)","Oxidative phosphorylation","Carbon metabolism","Thermogenesis","Non-alcoholic fatty liver disease","Parkinson disease","Prion disease","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy","Citric acid cycle (TCA cycle)"]	12	["Orphanet (Carney-stratakis syndrome)","CTD (Carney-stratakis syndrome)","ClinVar (Carney-stratakis syndrome)","GenCC (Carney-stratakis syndrome)","Orphanet (Cowden disease)","Disgenet (Mitochondrial disease)","CTD (Paraganglioma)","HPO (Paraganglioma)","Disgenet (Paraganglioma)","ClinVar (Pheochromocytoma\/paraganglioma syndrome)","HPO (Pheochromocytoma\/paraganglioma syndrome)","ClinGen (hereditary pheochromocytoma-paraganglioma)"]
SDHA	7	["Carney complex","Carney-stratakis syndrome","Gastrointestinal stromal tumor","Mitochondrial disease","Paraganglioma","Pheochromocytoma\/paraganglioma syndrome","hereditary pheochromocytoma-paraganglioma"]	10	["Citrate cycle (TCA cycle)","Oxidative phosphorylation","Carbon metabolism","Thermogenesis","Non-alcoholic fatty liver disease","Parkinson disease","Prion disease","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy","Citric acid cycle (TCA cycle)"]	8	["Disgenet (Carney complex)","Orphanet (Carney complex)","Orphanet (Carney-stratakis syndrome)","Orphanet (Gastrointestinal stromal tumor)","Disgenet (Paraganglioma)","ClinVar (Pheochromocytoma\/paraganglioma syndrome)","HPO (Pheochromocytoma\/paraganglioma syndrome)","ClinGen (hereditary pheochromocytoma-paraganglioma)"]
COX6A1	3	["Charcot-marie-tooth disease","Hereditary motor and sensory neuropathies","Mitochondrial disease"]	7	["Oxidative phosphorylation","Thermogenesis","Non-alcoholic fatty liver disease","Parkinson disease","Prion disease","Chemical carcinogenesis - reactive oxygen species","Diabetic cardiomyopathy"]	3	["Disgenet (Charcot-marie-tooth disease)","Disgenet (Hereditary motor and sensory neuropathies)","Disgenet (Mitochondrial disease)"]
SDHAF2	3	["Paraganglioma","Pheochromocytoma\/paraganglioma syndrome","hereditary pheochromocytoma-paraganglioma"]	0	[]	6	["CTD (Paraganglioma)","Disgenet (Paraganglioma)","ClinVar (Pheochromocytoma\/paraganglioma syndrome)","HPO (Pheochromocytoma\/paraganglioma syndrome)","Disgenet (Pheochromocytoma\/paraganglioma syndrome)","ClinGen (hereditary pheochromocytoma-paraganglioma)"]

Diseases Linked via Similar Genes

Mitochondrial complex deficiency Linked via 3 of 5 related genesSDHB, SDHD, SDHA Pheochromocytoma Linked via 2 of 5 related genesSDHB, SDHD Alzheimer disease Linked via 1 of 5 related genesSDHB Von hippel-lindau syndrome Linked via 1 of 5 related genesSDHB Carcinoid syndrome Linked via 1 of 5 related genesSDHD

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Mitochondrial complex deficiency	3	["SDHB","SDHD","SDHA"]
Pheochromocytoma	2	["SDHB","SDHD"]
Alzheimer disease	1	["SDHB"]
Von hippel-lindau syndrome	1	["SDHB"]
Carcinoid syndrome	1	["SDHD"]