Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	112483
Gene name	Spermidine/spermine N1-acetyltransferase family member 2
Gene symbol	SAT2
Synonyms (NCBI Gene)	SSAT-2SSAT2
Chromosome	17
Chromosome location	17p13.1

11 Show/Hide all (11)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045126	hsa-miR-186-5p	CLASH	23622248
MIRT739045	hsa-miR-520f	HITS-CLIP	33718276
MIRT2321280	hsa-miR-1321	CLIP-seq
MIRT2321281	hsa-miR-3667-3p	CLIP-seq
MIRT2321282	hsa-miR-4270	CLIP-seq
MIRT2321283	hsa-miR-4441	CLIP-seq
MIRT2321284	hsa-miR-4667-3p	CLIP-seq
MIRT2321285	hsa-miR-4685-5p	CLIP-seq
MIRT2321286	hsa-miR-4691-5p	CLIP-seq
MIRT2321287	hsa-miR-4739	CLIP-seq
MIRT2321288	hsa-miR-4756-5p	CLIP-seq

17 Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004145	Function	Diamine N-acetyltransferase activity	IDA	15283699
GO:0004145	Function	Diamine N-acetyltransferase activity	IDA	12803540
GO:0005515	Function	Protein binding	IPI	16189514, 31515488, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0006596	Process	Polyamine biosynthetic process	IDA	15283699
GO:0008080	Function	N-acetyltransferase activity	IBA
GO:0008080	Function	N-acetyltransferase activity	IDA	15283699
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0016747	Function	Acyltransferase activity, transferring groups other than amino-acyl groups	IEA
GO:0032918	Process	Spermidine acetylation	IDA	15283699
GO:0032918	Process	Spermidine acetylation	IDA	12803540
GO:0032919	Process	Spermine acetylation	IDA	12803540
GO:0032920	Process	Putrescine acetylation	IDA	12803540
GO:0042802	Function	Identical protein binding	IPI	25416956, 31515488, 32296183
GO:0046204	Process	Nor-spermidine metabolic process	IDA	12803540
GO:0070062	Component	Extracellular exosome	HDA	19056867

MIM	HGNC	e!Ensembl
611463	23160	ENSG00000141504

Q96F10

Protein name

Thialysine N-epsilon-acetyltransferase (EC 2.3.1.-) (Diamine acetyltransferase 2) (EC 2.3.1.57) (Spermidine/spermine N(1)-acetyltransferase 2) (SSAT-2)

Protein function

Catalyzes the N-acetylation of the amino acid thialysine (S-(2-aminoethyl)-L-cysteine), a L-lysine analog with the 4-methylene group substituted with a sulfur (PubMed:15283699). May also catalyze acetylation of polyamines, such as norspermidine,

PDB

2BEI , 2Q4V

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00583	Acetyltransf_1	16 → 145	Acetyltransferase (GNAT) family	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed (PubMed:12803540, PubMed:15283699). Under physiological conditions, SSAT2 is expressed at lower level that SSAT1 (SSAT). Many tissues express only SSAT1, several tissues express both SSAT1 and SSAT2, and bone, cervix,

Sequence

MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEIL
PAPGKLLGPCVVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDK
GCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEATRKLAGK

Sequence length

170

Interactions

View interactions

KEGG Pathway
Arginine and proline metabolism
Metabolic pathways
Ferroptosis

SAT2 (spermidine/spermine N1-acetyltransferase family member 2)

Bookmark This Gene