Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	6176
Gene name	Ribosomal protein lateral stalk subunit P1
Gene symbol	RPLP1
Synonyms (NCBI Gene)	LP1P1RPP1
Chromosome	15
Chromosome location	15q23
Summary	Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal pho

111 Show/Hide all (111)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029812	hsa-miR-26b-5p	Microarray	19088304
MIRT031818	hsa-miR-16-5p	Proteomics	18668040
MIRT049854	hsa-miR-32-5p	CLASH	23622248
MIRT049385	hsa-miR-92a-3p	CLASH	23622248
MIRT048543	hsa-miR-100-5p	CLASH	23622248
MIRT047014	hsa-miR-204-5p	CLASH	23622248
MIRT044994	hsa-miR-186-5p	CLASH	23622248
MIRT044994	hsa-miR-186-5p	CLASH	23622248
MIRT044726	hsa-miR-320a	CLASH	23622248
MIRT044726	hsa-miR-320a	CLASH	23622248
MIRT042894	hsa-miR-324-3p	CLASH	23622248
MIRT042584	hsa-miR-423-3p	CLASH	23622248
MIRT042584	hsa-miR-423-3p	CLASH	23622248
MIRT038374	hsa-miR-296-3p	CLASH	23622248
MIRT037548	hsa-miR-744-5p	CLASH	23622248
MIRT037548	hsa-miR-744-5p	CLASH	23622248
MIRT037205	hsa-miR-877-5p	CLASH	23622248
MIRT037205	hsa-miR-877-5p	CLASH	23622248
MIRT037205	hsa-miR-877-5p	CLASH	23622248
MIRT035944	hsa-miR-1180-3p	CLASH	23622248
MIRT052811	hsa-miR-3188	CLASH	23622248
MIRT052847	hsa-miR-3605-3p	CLASH	23622248
MIRT616861	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT616860	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT616859	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT616858	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT616861	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT616860	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT616859	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT616858	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT616861	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT616860	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT616859	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT616858	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT616861	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT616860	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT616859	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT616858	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT616861	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT616860	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT616859	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT616858	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT616861	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT616860	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT616859	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT616858	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT626842	hsa-miR-4464	HITS-CLIP	23824327
MIRT626841	hsa-miR-4748	HITS-CLIP	23824327
MIRT616861	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT616860	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT616859	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT616858	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT616861	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT616860	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT616859	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT616858	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT616861	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT616860	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT616859	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT616858	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT510129	hsa-miR-208a-5p	PAR-CLIP	20371350
MIRT510128	hsa-miR-208b-5p	PAR-CLIP	20371350
MIRT510129	hsa-miR-208a-5p	PAR-CLIP	23446348
MIRT510128	hsa-miR-208b-5p	PAR-CLIP	23446348
MIRT616861	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT616860	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT616859	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT616858	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT616861	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT616860	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT616859	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT616858	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT616861	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT616860	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT616859	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT616858	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT616861	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT616860	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT616859	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT616858	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT616861	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT616860	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT616859	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT616858	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT616861	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT616860	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT616859	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT616858	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT626842	hsa-miR-4464	HITS-CLIP	23824327
MIRT626841	hsa-miR-4748	HITS-CLIP	23824327
MIRT616861	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT616860	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT616859	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT616858	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT616861	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT616860	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT616859	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT616858	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT616861	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT616860	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT616859	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT616858	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT510129	hsa-miR-208a-5p	PAR-CLIP	20371350
MIRT510128	hsa-miR-208b-5p	PAR-CLIP	20371350
MIRT510129	hsa-miR-208a-5p	PAR-CLIP	23446348
MIRT510128	hsa-miR-208b-5p	PAR-CLIP	23446348
MIRT1317073	hsa-miR-3163	CLIP-seq
MIRT1317074	hsa-miR-340	CLIP-seq
MIRT1317074	hsa-miR-340	CLIP-seq
MIRT1317073	hsa-miR-3163	CLIP-seq
MIRT1317074	hsa-miR-340	CLIP-seq

23 Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002181	Process	Cytoplasmic translation	IBA
GO:0002181	Process	Cytoplasmic translation	IC	23636399
GO:0002181	Process	Cytoplasmic translation	NAS	25901680
GO:0003735	Function	Structural constituent of ribosome	IBA
GO:0003735	Function	Structural constituent of ribosome	IDA	3323886, 23636399
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0003735	Function	Structural constituent of ribosome	NAS	12962325
GO:0005515	Function	Protein binding	IPI	12054647, 22113938, 22135285, 32296183, 35271311
GO:0005737	Component	Cytoplasm	NAS	25901680
GO:0005829	Component	Cytosol	TAS
GO:0005840	Component	Ribosome	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006412	Process	Translation	NAS	12962325
GO:0006414	Process	Translational elongation	IEA
GO:0022625	Component	Cytosolic large ribosomal subunit	HDA	12962325
GO:0022625	Component	Cytosolic large ribosomal subunit	IBA
GO:0022625	Component	Cytosolic large ribosomal subunit	IDA	3323886
GO:0022625	Component	Cytosolic large ribosomal subunit	IEA
GO:0022625	Component	Cytosolic large ribosomal subunit	IPI	25901680
GO:0022626	Component	Cytosolic ribosome	IDA	23636399
GO:0030295	Function	Protein kinase activator activity	IBA
GO:0043021	Function	Ribonucleoprotein complex binding	IBA
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
180520	10372	ENSG00000137818

P05386

Protein name

Large ribosomal subunit protein P1 (60S acidic ribosomal protein P1)

Protein function

Plays an important role in the elongation step of protein synthesis.

PDB

2LBF , 4BEH , 4V6X

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00428	Ribosomal_60s	22 → 113		Family

Sequence

MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLI
CNVGAGGPAPAAGAAPAGGPAPSTAAAPAEEKKVEAKKEESEESDDDMGFGLFD

Sequence length

114

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Ribosome	L13a-mediated translational silencing of Ceruloplasmin expression
Coronavirus disease - COVID-19	SRP-dependent cotranslational protein targeting to membrane
	Viral mRNA Translation
	Major pathway of rRNA processing in the nucleolus and cytosol
	Formation of a pool of free 40S subunits
	GTP hydrolysis and joining of the 60S ribosomal subunit
	Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)
	Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
RPL35	[]	10	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Formation of a pool of free 40S subunits","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation","Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)"]	[]
RPL10L	[]	10	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Formation of a pool of free 40S subunits","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation","Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)"]	[]
RPL22L1	[]	10	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Formation of a pool of free 40S subunits","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation","Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)"]	[]
RPL13A	[]	10	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Formation of a pool of free 40S subunits","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation","Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)"]	[]
RPL36	[]	10	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Formation of a pool of free 40S subunits","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation","Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)"]	[]

RPLP1 (ribosomal protein lateral stalk subunit P1)

Bookmark This Gene