Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	6175
Gene name	Ribosomal protein lateral stalk subunit P0
Gene symbol	RPLP0
Synonyms (NCBI Gene)	L10ELP0P0PRLP0RPP0uL10
Chromosome	12
Chromosome location	12q24.23
Summary	Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal pro

71 Show/Hide all (71)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031708	hsa-miR-16-5p	Proteomics	18668040
MIRT031708	hsa-miR-16-5p	CLASH	23622248
MIRT047798	hsa-miR-30d-5p	CLASH	23622248
MIRT047112	hsa-miR-183-5p	CLASH	23622248
MIRT046937	hsa-miR-221-3p	CLASH	23622248
MIRT046464	hsa-miR-15b-5p	CLASH	23622248
MIRT045966	hsa-miR-125b-5p	CLASH	23622248
MIRT045668	hsa-miR-149-5p	CLASH	23622248
MIRT044152	hsa-miR-30e-5p	CLASH	23622248
MIRT043394	hsa-miR-331-3p	CLASH	23622248
MIRT042891	hsa-miR-324-3p	CLASH	23622248
MIRT041756	hsa-miR-484	CLASH	23622248
MIRT041756	hsa-miR-484	CLASH	23622248
MIRT041065	hsa-miR-505-3p	CLASH	23622248
MIRT040629	hsa-miR-92b-3p	CLASH	23622248
MIRT563348	hsa-miR-548a-3p	PAR-CLIP	20371350
MIRT563347	hsa-miR-548ar-3p	PAR-CLIP	20371350
MIRT563346	hsa-miR-548az-3p	PAR-CLIP	20371350
MIRT563345	hsa-miR-548e-3p	PAR-CLIP	20371350
MIRT563344	hsa-miR-548f-3p	PAR-CLIP	20371350
MIRT563343	hsa-miR-5582-3p	PAR-CLIP	20371350
MIRT563342	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT563341	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT563340	hsa-miR-892b	PAR-CLIP	20371350
MIRT563339	hsa-miR-4794	PAR-CLIP	20371350
MIRT563338	hsa-miR-664a-5p	PAR-CLIP	20371350
MIRT563337	hsa-miR-2052	PAR-CLIP	20371350
MIRT563336	hsa-miR-19a-5p	PAR-CLIP	20371350
MIRT563335	hsa-miR-19b-1-5p	PAR-CLIP	20371350
MIRT563334	hsa-miR-19b-2-5p	PAR-CLIP	20371350
MIRT563333	hsa-miR-502-5p	PAR-CLIP	20371350
MIRT247527	hsa-miR-548aw	PAR-CLIP	20371350
MIRT563332	hsa-miR-518a-5p	PAR-CLIP	20371350
MIRT563331	hsa-miR-527	PAR-CLIP	20371350
MIRT247523	hsa-miR-450b-5p	PAR-CLIP	20371350
MIRT563330	hsa-miR-507	PAR-CLIP	20371350
MIRT563329	hsa-miR-557	PAR-CLIP	20371350
MIRT563328	hsa-miR-3680-3p	PAR-CLIP	20371350
MIRT563348	hsa-miR-548a-3p	PAR-CLIP	20371350
MIRT563347	hsa-miR-548ar-3p	PAR-CLIP	20371350
MIRT563346	hsa-miR-548az-3p	PAR-CLIP	20371350
MIRT563345	hsa-miR-548e-3p	PAR-CLIP	20371350
MIRT563344	hsa-miR-548f-3p	PAR-CLIP	20371350
MIRT563343	hsa-miR-5582-3p	PAR-CLIP	20371350
MIRT563342	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT563341	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT563340	hsa-miR-892b	PAR-CLIP	20371350
MIRT563339	hsa-miR-4794	PAR-CLIP	20371350
MIRT563338	hsa-miR-664a-5p	PAR-CLIP	20371350
MIRT563337	hsa-miR-2052	PAR-CLIP	20371350
MIRT563336	hsa-miR-19a-5p	PAR-CLIP	20371350
MIRT563335	hsa-miR-19b-1-5p	PAR-CLIP	20371350
MIRT563334	hsa-miR-19b-2-5p	PAR-CLIP	20371350
MIRT563333	hsa-miR-502-5p	PAR-CLIP	20371350
MIRT247527	hsa-miR-548aw	PAR-CLIP	20371350
MIRT563332	hsa-miR-518a-5p	PAR-CLIP	20371350
MIRT563331	hsa-miR-527	PAR-CLIP	20371350
MIRT247523	hsa-miR-450b-5p	PAR-CLIP	20371350
MIRT563330	hsa-miR-507	PAR-CLIP	20371350
MIRT563329	hsa-miR-557	PAR-CLIP	20371350
MIRT563328	hsa-miR-3680-3p	PAR-CLIP	20371350
MIRT755885	hsa-miR-4731-5p	Luciferase reporter assayWestern blottingqRT-PCR	35342398
MIRT1317068	hsa-miR-186	CLIP-seq
MIRT1317069	hsa-miR-3133	CLIP-seq
MIRT1317070	hsa-miR-382	CLIP-seq
MIRT1317071	hsa-miR-548e	CLIP-seq
MIRT1317072	hsa-miR-548f	CLIP-seq
MIRT2094124	hsa-miR-3140-3p	CLIP-seq
MIRT1317070	hsa-miR-382	CLIP-seq
MIRT1317071	hsa-miR-548e	CLIP-seq
MIRT1317072	hsa-miR-548f	CLIP-seq

Transcription factor	Regulation	Reference
EZH2	Activation	17676662

35 Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002181	Process	Cytoplasmic translation	IBA
GO:0002181	Process	Cytoplasmic translation	IC	23636399
GO:0002181	Process	Cytoplasmic translation	NAS	25901680
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003735	Function	Structural constituent of ribosome	IBA
GO:0003735	Function	Structural constituent of ribosome	IDA	3323886, 23636399
GO:0003735	Function	Structural constituent of ribosome	NAS	12962325
GO:0005515	Function	Protein binding	IPI	15121898, 15303970, 15380484, 19188445, 22720776, 24658146, 25416956, 28514442, 33961781
GO:0005634	Component	Nucleus	IDA	19188445, 22720776
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	19188445
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	25901680
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005840	Component	Ribosome	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006412	Process	Translation	NAS	12962325
GO:0014069	Component	Postsynaptic density	EXP	21170055
GO:0014069	Component	Postsynaptic density	IDA	21170055
GO:0016020	Component	Membrane	HDA	19946888
GO:0022625	Component	Cytosolic large ribosomal subunit	HDA	12962325
GO:0022625	Component	Cytosolic large ribosomal subunit	IBA
GO:0022625	Component	Cytosolic large ribosomal subunit	IDA	3323886
GO:0022625	Component	Cytosolic large ribosomal subunit	IPI	25901680
GO:0022626	Component	Cytosolic ribosome	IDA	23636399
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA	15121898
GO:0042254	Process	Ribosome biogenesis	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070180	Function	Large ribosomal subunit rRNA binding	IBA
GO:0098794	Component	Postsynapse	EXP	23071613
GO:0098794	Component	Postsynapse	IDA	23071613
GO:1990904	Component	Ribonucleoprotein complex	IDA	17289661
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
180510	10371	ENSG00000089157

P05388

Protein name

Large ribosomal subunit protein uL10 (60S acidic ribosomal protein P0) (60S ribosomal protein L10E)

Protein function

Ribosomal protein P0 is the functional equivalent of E.coli protein L10.

PDB

4V6W , 4V6X , 5AJ0 , 6OLG , 6ZM7 , 6ZME , 6ZMI , 6ZMO , 8G5Z , 8G60 , 8G6J , 8K2C , 8UKB , 8XSX , 8XSY , 8XSZ , 8YOO , 8YOP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00428	Ribosomal_60s	231 → 316		Family
PF00466	Ribosomal_L10	5 → 106	Ribosomal protein L10	Family
PF17777	RL10P_insert	111 → 180	Insertion domain in 60S ribosomal protein L10P	Domain

Sequence

MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTM
MRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCE
VTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNI
SPFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGYPTVASVPHS
IINGYKRVLALSVETDYTFPLAEKVKAFLADPSAFVAAAPVAAATTAAPAAAAAPAKVEA
KEESEESDEDMGFGLFD

Sequence length

317

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Ribosome	L13a-mediated translational silencing of Ceruloplasmin expression
Coronavirus disease - COVID-19	SRP-dependent cotranslational protein targeting to membrane
	Viral mRNA Translation
	Major pathway of rRNA processing in the nucleolus and cytosol
	Formation of a pool of free 40S subunits
	GTP hydrolysis and joining of the 60S ribosomal subunit
	Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation
	Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)
	Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
RPL35	[]	10	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Formation of a pool of free 40S subunits","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation","Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)"]	[]
RPL10L	[]	10	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Formation of a pool of free 40S subunits","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation","Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)"]	[]
RPL22L1	[]	10	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Formation of a pool of free 40S subunits","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation","Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)"]	[]
RPL13A	[]	10	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Formation of a pool of free 40S subunits","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation","Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)"]	[]
RPL36	[]	10	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Formation of a pool of free 40S subunits","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation","Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)"]	[]

RPLP0 (ribosomal protein lateral stalk subunit P0)

Save This Analysis