Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	6166
Gene name	Ribosomal protein L36a like
Gene symbol	RPL36AL
Synonyms (NCBI Gene)	RPL36ARPL36AP42RPL36A_18_1363
Chromosome	14
Chromosome location	14q21.3
Summary	Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribos

36 Show/Hide all (36)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043108	hsa-miR-324-5p	CLASH	23622248
MIRT039830	hsa-miR-615-3p	CLASH	23622248
MIRT038327	hsa-miR-130b-5p	CLASH	23622248
MIRT1316885	hsa-miR-1208	CLIP-seq
MIRT1316886	hsa-miR-1236	CLIP-seq
MIRT1316887	hsa-miR-135a	CLIP-seq
MIRT1316888	hsa-miR-135b	CLIP-seq
MIRT1316889	hsa-miR-197	CLIP-seq
MIRT1316890	hsa-miR-34c-3p	CLIP-seq
MIRT1316891	hsa-miR-412	CLIP-seq
MIRT1316892	hsa-miR-4446-5p	CLIP-seq
MIRT1316893	hsa-miR-4655-3p	CLIP-seq
MIRT1316894	hsa-miR-4698	CLIP-seq
MIRT1316895	hsa-miR-4742-3p	CLIP-seq
MIRT1316896	hsa-miR-4753-3p	CLIP-seq
MIRT1316897	hsa-miR-4755-5p	CLIP-seq
MIRT1316898	hsa-miR-4768-5p	CLIP-seq
MIRT1316899	hsa-miR-642a	CLIP-seq
MIRT1316885	hsa-miR-1208	CLIP-seq
MIRT1316887	hsa-miR-135a	CLIP-seq
MIRT1316888	hsa-miR-135b	CLIP-seq
MIRT1316889	hsa-miR-197	CLIP-seq
MIRT1316890	hsa-miR-34c-3p	CLIP-seq
MIRT1316891	hsa-miR-412	CLIP-seq
MIRT1316892	hsa-miR-4446-5p	CLIP-seq
MIRT1316893	hsa-miR-4655-3p	CLIP-seq
MIRT1316895	hsa-miR-4742-3p	CLIP-seq
MIRT1316897	hsa-miR-4755-5p	CLIP-seq
MIRT1316899	hsa-miR-642a	CLIP-seq
MIRT1316885	hsa-miR-1208	CLIP-seq
MIRT1316890	hsa-miR-34c-3p	CLIP-seq
MIRT1316892	hsa-miR-4446-5p	CLIP-seq
MIRT1316893	hsa-miR-4655-3p	CLIP-seq
MIRT1316895	hsa-miR-4742-3p	CLIP-seq
MIRT1316897	hsa-miR-4755-5p	CLIP-seq
MIRT1316899	hsa-miR-642a	CLIP-seq

13 Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002181	Process	Cytoplasmic translation	IBA
GO:0003735	Function	Structural constituent of ribosome	IBA
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005634	Component	Nucleus	IDA	25468996
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005840	Component	Ribosome	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0006412	Process	Translation	IEA
GO:0022625	Component	Cytosolic large ribosomal subunit	IBA
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
180469	10346	ENSG00000165502

Q969Q0

Protein name

Ribosomal protein eL42-like (60S ribosomal protein L36a-like) (Large ribosomal subunit protein eL42-like)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00935	Ribosomal_L44	17 → 94	Ribosomal protein L44	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:12490704}.

Sequence

MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKA
KTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF

Sequence length

106

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Ribosome	L13a-mediated translational silencing of Ceruloplasmin expression
Coronavirus disease - COVID-19	SRP-dependent cotranslational protein targeting to membrane
	Viral mRNA Translation
	Major pathway of rRNA processing in the nucleolus and cytosol
	Formation of a pool of free 40S subunits
	GTP hydrolysis and joining of the 60S ribosomal subunit
	Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)
	Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
RPL35	[]	10	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Formation of a pool of free 40S subunits","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation","Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)"]	[]
RPL10L	[]	10	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Formation of a pool of free 40S subunits","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation","Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)"]	[]
RPL22L1	[]	10	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Formation of a pool of free 40S subunits","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation","Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)"]	[]
RPL13A	[]	10	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Formation of a pool of free 40S subunits","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation","Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)"]	[]
RPL36	[]	10	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Formation of a pool of free 40S subunits","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation","Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)"]	[]

RPL36AL (ribosomal protein L36a like)

Bookmark This Gene