RPL26L1 (ribosomal protein L26 like 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 51121
Gene name Ribosomal protein L26 like 1
Gene symbol RPL26L1
Synonyms (NCBI Gene)
RPL26P1
Chromosome 5
Chromosome location 5q35.1
Summary This gene encodes a protein that shares high sequence similarity with ribosomal protein L26. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Dec 2015]
miRNA miRNA information provided by mirtarbase database.
3
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT039374 hsa-miR-421 CLASH 23622248
MIRT2318598 hsa-miR-4797-5p CLIP-seq
MIRT2318599 hsa-miR-495 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13 Show/Hide all (13)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002181 Process Cytoplasmic translation IBA
GO:0003723 Function RNA binding IBA
GO:0003723 Function RNA binding IEA
GO:0003735 Function Structural constituent of ribosome IBA
GO:0003735 Function Structural constituent of ribosome IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UNX3
Protein name Ribosomal protein uL24-like (60S ribosomal protein L26-like 1) (Large ribosomal subunit protein uL24-like 1)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00467 KOW 51 → 97 KOW motif Family
PF16906 Ribosomal_L26 8 → 122 Ribosomal proteins L26 eukaryotic, L24P archaeal Family
Sequence 
MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRG
HYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILE
RKAKSRQVGKEKGKYKEELIEKMQE
Sequence length 145
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Ribosome L13a-mediated translational silencing of Ceruloplasmin expression
Coronavirus disease - COVID-19 SRP-dependent cotranslational protein targeting to membrane
  Viral mRNA Translation
  Major pathway of rRNA processing in the nucleolus and cytosol
  Formation of a pool of free 40S subunits
  GTP hydrolysis and joining of the 60S ribosomal subunit
  Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)
  Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)
Sort by:
RPL35 10 shared pathwaysRibosome, Coronavirus disease - COVID-19, Major pathway of rRNA processing in the nucleolus and cytosol, L13a-mediated translational silencing of Ceruloplasmin expression, Formation of a pool of free 40S subunits, GTP hydrolysis and joining of the 60S ribosomal subunit, Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC), SRP-dependent cotranslational protein targeting to membrane, Viral mRNA Translation, Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC) Related via 10 shared pathways including Ribosome, Coronavirus disease - COVID-19. RPL10L 10 shared pathwaysRibosome, Coronavirus disease - COVID-19, Major pathway of rRNA processing in the nucleolus and cytosol, L13a-mediated translational silencing of Ceruloplasmin expression, Formation of a pool of free 40S subunits, GTP hydrolysis and joining of the 60S ribosomal subunit, Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC), SRP-dependent cotranslational protein targeting to membrane, Viral mRNA Translation, Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC) Related via 10 shared pathways including Ribosome, Coronavirus disease - COVID-19. RPL22L1 10 shared pathwaysRibosome, Coronavirus disease - COVID-19, Major pathway of rRNA processing in the nucleolus and cytosol, L13a-mediated translational silencing of Ceruloplasmin expression, Formation of a pool of free 40S subunits, GTP hydrolysis and joining of the 60S ribosomal subunit, Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC), SRP-dependent cotranslational protein targeting to membrane, Viral mRNA Translation, Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC) Related via 10 shared pathways including Ribosome, Coronavirus disease - COVID-19. RPL13A 10 shared pathwaysRibosome, Coronavirus disease - COVID-19, Major pathway of rRNA processing in the nucleolus and cytosol, L13a-mediated translational silencing of Ceruloplasmin expression, Formation of a pool of free 40S subunits, GTP hydrolysis and joining of the 60S ribosomal subunit, Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC), SRP-dependent cotranslational protein targeting to membrane, Viral mRNA Translation, Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC) Related via 10 shared pathways including Ribosome, Coronavirus disease - COVID-19. RPL36 10 shared pathwaysRibosome, Coronavirus disease - COVID-19, Major pathway of rRNA processing in the nucleolus and cytosol, L13a-mediated translational silencing of Ceruloplasmin expression, Formation of a pool of free 40S subunits, GTP hydrolysis and joining of the 60S ribosomal subunit, Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC), SRP-dependent cotranslational protein targeting to membrane, Viral mRNA Translation, Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC) Related via 10 shared pathways including Ribosome, Coronavirus disease - COVID-19.
Diabetes mellitus type 2 Linked via 2 of 5 related genesRPL10L, RPL22L1 Diamond-blackfan anemia Linked via 1 of 5 related genesRPL35 Anorexia nervosa Linked via 1 of 5 related genesRPL10L Attention deficit hyperactivity disorder Linked via 1 of 5 related genesRPL10L Central nervous system cancer Linked via 1 of 5 related genesRPL10L