Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	6136
Gene name	Ribosomal protein L12
Gene symbol	RPL12
Synonyms (NCBI Gene)	L12uL11
Chromosome	9
Chromosome location	9q33.3
Summary	Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal pro

80 Show/Hide all (80)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031402	hsa-miR-16-5p	Proteomics	18668040
MIRT051997	hsa-let-7b-5p	CLASH	23622248
MIRT051475	hsa-let-7e-5p	CLASH	23622248
MIRT046988	hsa-miR-218-5p	CLASH	23622248
MIRT046650	hsa-miR-222-3p	CLASH	23622248
MIRT046558	hsa-let-7g-5p	CLASH	23622248
MIRT041418	hsa-miR-193b-3p	CLASH	23622248
MIRT682960	hsa-miR-141-3p	HITS-CLIP	23706177
MIRT682959	hsa-miR-200a-3p	HITS-CLIP	23706177
MIRT682958	hsa-miR-508-5p	HITS-CLIP	23706177
MIRT682957	hsa-miR-335-5p	HITS-CLIP	23706177
MIRT682956	hsa-miR-6849-3p	HITS-CLIP	23706177
MIRT682955	hsa-miR-939-3p	HITS-CLIP	23706177
MIRT682954	hsa-miR-766-3p	HITS-CLIP	23706177
MIRT682953	hsa-miR-4793-3p	HITS-CLIP	23706177
MIRT682952	hsa-miR-1285-3p	HITS-CLIP	23706177
MIRT682951	hsa-miR-3187-5p	HITS-CLIP	23706177
MIRT682950	hsa-miR-5189-5p	HITS-CLIP	23706177
MIRT682949	hsa-miR-612	HITS-CLIP	23706177
MIRT682948	hsa-miR-6860	HITS-CLIP	23706177
MIRT682947	hsa-miR-661	HITS-CLIP	23706177
MIRT682946	hsa-miR-31-5p	HITS-CLIP	23706177
MIRT682945	hsa-miR-6512-3p	HITS-CLIP	23706177
MIRT682944	hsa-miR-6720-5p	HITS-CLIP	23706177
MIRT682943	hsa-miR-7703	HITS-CLIP	23706177
MIRT682942	hsa-miR-1273g-3p	HITS-CLIP	23706177
MIRT446160	hsa-miR-134-3p	PAR-CLIP	22100165
MIRT446159	hsa-miR-539-5p	PAR-CLIP	22100165
MIRT446158	hsa-miR-873-3p	PAR-CLIP	22100165
MIRT446157	hsa-miR-4747-5p	PAR-CLIP	22100165
MIRT446156	hsa-miR-5196-5p	PAR-CLIP	22100165
MIRT446155	hsa-miR-4648	PAR-CLIP	22100165
MIRT446154	hsa-miR-1233-5p	PAR-CLIP	22100165
MIRT446153	hsa-miR-6778-5p	PAR-CLIP	22100165
MIRT446152	hsa-miR-4654	PAR-CLIP	22100165
MIRT446150	hsa-miR-4769-5p	PAR-CLIP	22100165
MIRT446151	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT446149	hsa-miR-3672	PAR-CLIP	22100165
MIRT446148	hsa-miR-6864-3p	PAR-CLIP	22100165
MIRT446149	hsa-miR-3672	PAR-CLIP	27292025
MIRT446148	hsa-miR-6864-3p	PAR-CLIP	27292025
MIRT682960	hsa-miR-141-3p	HITS-CLIP	23706177
MIRT682959	hsa-miR-200a-3p	HITS-CLIP	23706177
MIRT682958	hsa-miR-508-5p	HITS-CLIP	23706177
MIRT682957	hsa-miR-335-5p	HITS-CLIP	23706177
MIRT682956	hsa-miR-6849-3p	HITS-CLIP	23706177
MIRT682955	hsa-miR-939-3p	HITS-CLIP	23706177
MIRT682954	hsa-miR-766-3p	HITS-CLIP	23706177
MIRT682953	hsa-miR-4793-3p	HITS-CLIP	23706177
MIRT682952	hsa-miR-1285-3p	HITS-CLIP	23706177
MIRT682951	hsa-miR-3187-5p	HITS-CLIP	23706177
MIRT682950	hsa-miR-5189-5p	HITS-CLIP	23706177
MIRT682949	hsa-miR-612	HITS-CLIP	23706177
MIRT682948	hsa-miR-6860	HITS-CLIP	23706177
MIRT682947	hsa-miR-661	HITS-CLIP	23706177
MIRT682946	hsa-miR-31-5p	HITS-CLIP	23706177
MIRT682945	hsa-miR-6512-3p	HITS-CLIP	23706177
MIRT682944	hsa-miR-6720-5p	HITS-CLIP	23706177
MIRT682943	hsa-miR-7703	HITS-CLIP	23706177
MIRT682942	hsa-miR-1273g-3p	HITS-CLIP	23706177
MIRT446160	hsa-miR-134-3p	PAR-CLIP	22100165
MIRT446159	hsa-miR-539-5p	PAR-CLIP	22100165
MIRT446158	hsa-miR-873-3p	PAR-CLIP	22100165
MIRT446157	hsa-miR-4747-5p	PAR-CLIP	22100165
MIRT446156	hsa-miR-5196-5p	PAR-CLIP	22100165
MIRT446155	hsa-miR-4648	PAR-CLIP	22100165
MIRT446154	hsa-miR-1233-5p	PAR-CLIP	22100165
MIRT446153	hsa-miR-6778-5p	PAR-CLIP	22100165
MIRT446152	hsa-miR-4654	PAR-CLIP	22100165
MIRT446150	hsa-miR-4769-5p	PAR-CLIP	22100165
MIRT446151	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT446149	hsa-miR-3672	PAR-CLIP	22100165
MIRT446148	hsa-miR-6864-3p	PAR-CLIP	22100165
MIRT1315858	hsa-miR-105	CLIP-seq
MIRT1315859	hsa-miR-203	CLIP-seq
MIRT1315860	hsa-miR-4307	CLIP-seq
MIRT1315861	hsa-miR-501-5p	CLIP-seq
MIRT1315858	hsa-miR-105	CLIP-seq
MIRT1315859	hsa-miR-203	CLIP-seq
MIRT1315861	hsa-miR-501-5p	CLIP-seq

28 Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002181	Process	Cytoplasmic translation	IC	23636399
GO:0002181	Process	Cytoplasmic translation	NAS	25901680
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003723	Function	RNA binding	IEA
GO:0003735	Function	Structural constituent of ribosome	IBA
GO:0003735	Function	Structural constituent of ribosome	IDA	23636399
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0003735	Function	Structural constituent of ribosome	NAS	12962325
GO:0005515	Function	Protein binding	IPI	22314232, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	25901680
GO:0005829	Component	Cytosol	TAS
GO:0005840	Component	Ribosome	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006412	Process	Translation	IBA
GO:0006412	Process	Translation	IEA
GO:0006412	Process	Translation	NAS	12962325
GO:0014069	Component	Postsynaptic density	EXP	21170055
GO:0014069	Component	Postsynaptic density	IDA	21170055
GO:0016020	Component	Membrane	HDA	19946888
GO:0022625	Component	Cytosolic large ribosomal subunit	HDA	12962325
GO:0022625	Component	Cytosolic large ribosomal subunit	IBA
GO:0022625	Component	Cytosolic large ribosomal subunit	IEA
GO:0022625	Component	Cytosolic large ribosomal subunit	IPI	25901680
GO:0022626	Component	Cytosolic ribosome	IDA	23636399
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070180	Function	Large ribosomal subunit rRNA binding	IBA
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
180475	10302	ENSG00000197958

P30050

Protein name

Large ribosomal subunit protein uL11 (60S ribosomal protein L12)

Protein function

Component of the large ribosomal subunit (PubMed:25901680). The ribosome is a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell (PubMed:25901680). Binds directly to 26S ribosomal RNA (PubMed:25901680). {ECO:00

PDB

4V6X , 5A8L , 5AJ0 , 6OLG , 6ZM7 , 6ZME , 6ZMI , 6ZMO , 7VB2 , 8FKR , 8FKS , 8FKT , 8FKU , 8FKV , 8FKW , 8FKX , 8FKY , 8FKZ , 8FL0 , 8FL2 , 8FL3 , 8FL4 , 8FL6 , 8FL7 , 8FL9 , 8FLA , 8FLB , 8FLC , 8G5Z , 8G60 , 8G6J , 8IDT , 8IDY , 8INE , 8INF , 8INK , 8IPD , 8IPX , 8IPY , 8IR1 , 8IR3 , 8K2C , 8RL2 , 8UKB , 8XSX , 8XSY , 8XSZ , 8YOO , 8YOP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00298	Ribosomal_L11	73 → 143	Ribosomal protein L11, RNA binding domain	Domain
PF03946	Ribosomal_L11_N	3 → 69	Ribosomal protein L11, N-terminal domain	Domain

Sequence

MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITV
KLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRS
LARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS

Sequence length

165

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Ribosome	L13a-mediated translational silencing of Ceruloplasmin expression
Coronavirus disease - COVID-19	SRP-dependent cotranslational protein targeting to membrane
	Viral mRNA Translation
	Major pathway of rRNA processing in the nucleolus and cytosol
	Formation of a pool of free 40S subunits
	GTP hydrolysis and joining of the 60S ribosomal subunit
	Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)
	Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	17013881	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (9)
Alzheimer Disease	Alzheimer disease	Pubtator	35766008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37526061	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	23603806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17013881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	23603806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	23603806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paralysis	Paralysis	Pubtator	22174689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17013881		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	18505066, 22468085	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
RPL35	[]	10	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Formation of a pool of free 40S subunits","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation","Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)"]	[]
RPL10L	[]	10	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Formation of a pool of free 40S subunits","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation","Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)"]	[]
RPL22L1	[]	10	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Formation of a pool of free 40S subunits","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation","Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)"]	[]
RPL13A	[]	10	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Formation of a pool of free 40S subunits","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation","Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)"]	[]
RPL36	[]	10	["Ribosome","Coronavirus disease - COVID-19","Major pathway of rRNA processing in the nucleolus and cytosol","L13a-mediated translational silencing of Ceruloplasmin expression","Formation of a pool of free 40S subunits","GTP hydrolysis and joining of the 60S ribosomal subunit","Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)","SRP-dependent cotranslational protein targeting to membrane","Viral mRNA Translation","Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)"]	[]

RPL12 (ribosomal protein L12)

Bookmark This Gene