RPA4 (replication protein A4)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 29935
Gene name Replication protein A4
Gene symbol RPA4
Synonyms (NCBI Gene)
HSU24186
Chromosome X
Chromosome location Xq21.33
Summary This gene encodes a single-stranded DNA-binding protein that is the 30-kDa subunit of the replication protein A complex. Replication protein A is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. The encoded prot
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
30 Show/Hide all (30)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000077 Process DNA damage checkpoint signaling IDA 19942684
GO:0000077 Process DNA damage checkpoint signaling IEA
GO:0000724 Process Double-strand break repair via homologous recombination IBA
GO:0000781 Component Chromosome, telomeric region IBA
GO:0003677 Function DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300767 30305 ENSG00000204086
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13156
Protein name Replication protein A 30 kDa subunit (RP-A p30) (Replication factor A protein 4) (RF-A protein 4)
Protein function As part of the alternative replication protein A complex, aRPA, binds single-stranded DNA and probably plays a role in DNA repair. Compared to the RPA2-containing, canonical RPA complex, may not support chromosomal DNA replication and cell cycle
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08784 RPA_C 159 → 255 Replication protein A C terminal Domain
Tissue specificity TISSUE SPECIFICITY: Preferentially expressed in placental and colon mucosa. Widely expressed at intermediate or lower levels. {ECO:0000269|PubMed:19996105}.
Sequence 
MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVF
DPVFKVRGIIVSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLS
VGVYVKVFGILKCPTGTKSLEVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESV
PVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCDLSVKAIKEAID
YLTVEGHIYPTVDREHFKSAD
Sequence length 261
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
DNA replication Activation of the pre-replicative complex
Nucleotide excision repair  
Mismatch repair  
Homologous recombination  
Fanconi anemia pathway  
Sort by:
SSBP1 3 shared pathwaysDNA replication, Mismatch repair, Homologous recombination Related via 3 shared pathways including DNA replication, Mismatch repair. TOP3B 2 shared pathwaysHomologous recombination, Fanconi anemia pathway Related via 2 shared pathways including Homologous recombination, Fanconi anemia pathway. EME1 2 shared pathwaysHomologous recombination, Fanconi anemia pathway Related via 2 shared pathways including Homologous recombination, Fanconi anemia pathway. MUS81 2 shared pathwaysHomologous recombination, Fanconi anemia pathway Related via 2 shared pathways including Homologous recombination, Fanconi anemia pathway. ERCC4 2 shared pathwaysNucleotide excision repair, Fanconi anemia pathway Related via 2 shared pathways including Nucleotide excision repair, Fanconi anemia pathway.
Schizophrenia Linked via 2 of 5 related genesTOP3B, ERCC4 Isolated sensorineural deafness Linked via 1 of 5 related genesSSBP1 Cone-rod dystrophy Linked via 1 of 5 related genesSSBP1 Dermatologic disorder Linked via 1 of 5 related genesSSBP1 Leigh syndrome Linked via 1 of 5 related genesSSBP1