Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	6048
Gene name	Ring finger protein 5
Gene symbol	RNF5
Synonyms (NCBI Gene)	RING5RMA1
Chromosome	6
Chromosome location	6p21.32
Summary	The protein encoded by this gene contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ubiquitination and alter

130

Show/Hide all (130)

miRTarBase ID	miRNA	Experiments	Reference
MIRT042288	hsa-miR-484	CLASH	23622248
MIRT1313522	hsa-let-7a	CLIP-seq
MIRT1313523	hsa-let-7b	CLIP-seq
MIRT1313524	hsa-let-7c	CLIP-seq
MIRT1313525	hsa-let-7d	CLIP-seq
MIRT1313526	hsa-let-7e	CLIP-seq
MIRT1313527	hsa-let-7f	CLIP-seq
MIRT1313528	hsa-let-7g	CLIP-seq
MIRT1313529	hsa-let-7i	CLIP-seq
MIRT1313530	hsa-miR-151-3p	CLIP-seq
MIRT1313531	hsa-miR-1915	CLIP-seq
MIRT1313532	hsa-miR-196a	CLIP-seq
MIRT1313533	hsa-miR-196b	CLIP-seq
MIRT1313534	hsa-miR-200b	CLIP-seq
MIRT1313535	hsa-miR-200c	CLIP-seq
MIRT1313536	hsa-miR-214	CLIP-seq
MIRT1313537	hsa-miR-2355-5p	CLIP-seq
MIRT1313538	hsa-miR-298	CLIP-seq
MIRT1313539	hsa-miR-3121-3p	CLIP-seq
MIRT1313540	hsa-miR-3123	CLIP-seq
MIRT1313541	hsa-miR-3149	CLIP-seq
MIRT1313542	hsa-miR-3150a-3p	CLIP-seq
MIRT1313543	hsa-miR-3173-3p	CLIP-seq
MIRT1313544	hsa-miR-3174	CLIP-seq
MIRT1313545	hsa-miR-3175	CLIP-seq
MIRT1313546	hsa-miR-3180	CLIP-seq
MIRT1313547	hsa-miR-3180-3p	CLIP-seq
MIRT1313548	hsa-miR-3184	CLIP-seq
MIRT1313549	hsa-miR-3196	CLIP-seq
MIRT1313550	hsa-miR-3202	CLIP-seq
MIRT1313551	hsa-miR-326	CLIP-seq
MIRT1313552	hsa-miR-330-5p	CLIP-seq
MIRT1313553	hsa-miR-3619-5p	CLIP-seq
MIRT1313554	hsa-miR-3667-3p	CLIP-seq
MIRT1313555	hsa-miR-3919	CLIP-seq
MIRT1313556	hsa-miR-3921	CLIP-seq
MIRT1313557	hsa-miR-423-5p	CLIP-seq
MIRT1313558	hsa-miR-429	CLIP-seq
MIRT1313559	hsa-miR-4291	CLIP-seq
MIRT1313560	hsa-miR-4303	CLIP-seq
MIRT1313561	hsa-miR-4426	CLIP-seq
MIRT1313562	hsa-miR-4433	CLIP-seq
MIRT1313563	hsa-miR-4436b-3p	CLIP-seq
MIRT1313564	hsa-miR-4458	CLIP-seq
MIRT1313565	hsa-miR-4468	CLIP-seq
MIRT1313566	hsa-miR-4488	CLIP-seq
MIRT1313567	hsa-miR-4500	CLIP-seq
MIRT1313568	hsa-miR-4522	CLIP-seq
MIRT1313569	hsa-miR-4647	CLIP-seq
MIRT1313570	hsa-miR-4653-5p	CLIP-seq
MIRT1313571	hsa-miR-4662b	CLIP-seq
MIRT1313572	hsa-miR-4667-5p	CLIP-seq
MIRT1313573	hsa-miR-4685-5p	CLIP-seq
MIRT1313574	hsa-miR-4697-5p	CLIP-seq
MIRT1313575	hsa-miR-4700-5p	CLIP-seq
MIRT1313576	hsa-miR-4765	CLIP-seq
MIRT1313577	hsa-miR-615-5p	CLIP-seq
MIRT1313578	hsa-miR-637	CLIP-seq
MIRT1313579	hsa-miR-665	CLIP-seq
MIRT1313580	hsa-miR-761	CLIP-seq
MIRT1313581	hsa-miR-921	CLIP-seq
MIRT1313582	hsa-miR-922	CLIP-seq
MIRT1313583	hsa-miR-939	CLIP-seq
MIRT1313584	hsa-miR-98	CLIP-seq
MIRT2093361	hsa-miR-149	CLIP-seq
MIRT2093362	hsa-miR-3064-5p	CLIP-seq
MIRT2093363	hsa-miR-3135b	CLIP-seq
MIRT1313542	hsa-miR-3150a-3p	CLIP-seq
MIRT2093364	hsa-miR-3166	CLIP-seq
MIRT1313545	hsa-miR-3175	CLIP-seq
MIRT1313551	hsa-miR-326	CLIP-seq
MIRT1313552	hsa-miR-330-5p	CLIP-seq
MIRT2093365	hsa-miR-3652	CLIP-seq
MIRT2093366	hsa-miR-3689d	CLIP-seq
MIRT2093367	hsa-miR-4257	CLIP-seq
MIRT2093368	hsa-miR-4430	CLIP-seq
MIRT2093369	hsa-miR-4505	CLIP-seq
MIRT2093370	hsa-miR-4659a-3p	CLIP-seq
MIRT2093371	hsa-miR-4659b-3p	CLIP-seq
MIRT2093372	hsa-miR-4794	CLIP-seq
MIRT2093373	hsa-miR-541	CLIP-seq
MIRT2093374	hsa-miR-654-5p	CLIP-seq
MIRT1313583	hsa-miR-939	CLIP-seq
MIRT2093375	hsa-miR-942	CLIP-seq
MIRT2317899	hsa-miR-1224-3p	CLIP-seq
MIRT1313531	hsa-miR-1915	CLIP-seq
MIRT1313534	hsa-miR-200b	CLIP-seq
MIRT1313535	hsa-miR-200c	CLIP-seq
MIRT1313537	hsa-miR-2355-5p	CLIP-seq
MIRT2093362	hsa-miR-3064-5p	CLIP-seq
MIRT1313540	hsa-miR-3123	CLIP-seq
MIRT2093363	hsa-miR-3135b	CLIP-seq
MIRT2317900	hsa-miR-3617	CLIP-seq
MIRT2093365	hsa-miR-3652	CLIP-seq
MIRT1313554	hsa-miR-3667-3p	CLIP-seq
MIRT2093366	hsa-miR-3689d	CLIP-seq
MIRT1313555	hsa-miR-3919	CLIP-seq
MIRT2093367	hsa-miR-4257	CLIP-seq
MIRT2317901	hsa-miR-4271	CLIP-seq
MIRT1313558	hsa-miR-429	CLIP-seq
MIRT2093368	hsa-miR-4430	CLIP-seq
MIRT1313562	hsa-miR-4433	CLIP-seq
MIRT1313563	hsa-miR-4436b-3p	CLIP-seq
MIRT2317902	hsa-miR-4471	CLIP-seq
MIRT2093369	hsa-miR-4505	CLIP-seq
MIRT1313573	hsa-miR-4685-5p	CLIP-seq
MIRT2317903	hsa-miR-4699-5p	CLIP-seq
MIRT2317904	hsa-miR-4709-3p	CLIP-seq
MIRT2317905	hsa-miR-4725-3p	CLIP-seq
MIRT2317906	hsa-miR-4768-5p	CLIP-seq
MIRT2093373	hsa-miR-541	CLIP-seq
MIRT1313577	hsa-miR-615-5p	CLIP-seq
MIRT2317907	hsa-miR-641	CLIP-seq
MIRT2093374	hsa-miR-654-5p	CLIP-seq
MIRT1313579	hsa-miR-665	CLIP-seq
MIRT2093361	hsa-miR-149	CLIP-seq
MIRT2093362	hsa-miR-3064-5p	CLIP-seq
MIRT2093363	hsa-miR-3135b	CLIP-seq
MIRT1313551	hsa-miR-326	CLIP-seq
MIRT1313552	hsa-miR-330-5p	CLIP-seq
MIRT2093365	hsa-miR-3652	CLIP-seq
MIRT2093366	hsa-miR-3689d	CLIP-seq
MIRT2093368	hsa-miR-4430	CLIP-seq
MIRT2093369	hsa-miR-4505	CLIP-seq
MIRT2093370	hsa-miR-4659a-3p	CLIP-seq
MIRT2093371	hsa-miR-4659b-3p	CLIP-seq
MIRT2093372	hsa-miR-4794	CLIP-seq
MIRT2093373	hsa-miR-541	CLIP-seq
MIRT2093374	hsa-miR-654-5p	CLIP-seq
MIRT2093375	hsa-miR-942	CLIP-seq

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	19269966
GO:0005515	Function	Protein binding	IPI	12861019, 14667819, 16901789, 19269966, 19549727, 20152160, 24019521, 25416956, 25759021, 26618866, 31515488, 32296183, 32814053, 33961781, 36012204
GO:0005739	Component	Mitochondrion	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IGI	24019521
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	TAS	9533025
GO:0009617	Process	Response to bacterium	IEA
GO:0010507	Process	Negative regulation of autophagy	IEA
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030163	Process	Protein catabolic process	IMP	19285439
GO:0031648	Process	Protein destabilization	IEA
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0036503	Process	ERAD pathway	IBA
GO:0036503	Process	ERAD pathway	IEA
GO:0036503	Process	ERAD pathway	IMP	19269966, 24019521
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0044322	Component	Endoplasmic reticulum quality control compartment	IEA
GO:0044390	Function	Ubiquitin-like protein conjugating enzyme binding	IBA
GO:0044877	Function	Protein-containing complex binding	IPI	24019521
GO:0046872	Function	Metal ion binding	IEA
GO:0055085	Process	Transmembrane transport	TAS
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	TAS	24019521
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	19269966
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	19285439
GO:1904380	Process	Endoplasmic reticulum mannose trimming	IEA
GO:1904380	Process	Endoplasmic reticulum mannose trimming	TAS
GO:2000785	Process	Regulation of autophagosome assembly	IEA

MIM	HGNC	e!Ensembl
602677	10068	ENSG00000204308

Q99942

Protein name

E3 ubiquitin-protein ligase RNF5 (EC 2.3.2.27) (RING finger protein 5) (Ram1 homolog) (HsRma1)

Protein function

Membrane-bound E3 ubiquitin-protein ligase that mediates ubiquitination of target proteins (PubMed:11329381, PubMed:12861019, PubMed:16176924, PubMed:19269966, PubMed:19285439). May function together with E2 ubiquitin-conjugating enzymes UBE2D1/

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13920	zf-C3HC4_3	23 → 73		Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:9533025}.

Sequence

MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPE
RQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGF
HFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI

Sequence length

180

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BEHCET'S SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMBRANOUS GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (31)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	17804730, 25759021, 31611975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17804730, 37816703	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36656913	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29514927, 32054686	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	21318260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	37635482	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30232010, 31257292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	19625452, 37440686	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	26183966, 29754957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	31746734	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30086518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	17632545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31611975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30232010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	17804730	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26074703, 30556603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	24871463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17804730, 25759021, 31611975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17804730		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17804730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	17804730	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	GWASCAT_DG	21323541		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	30086518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	37635482	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	20598377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17804730, 26074703, 26356813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	37635482	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17804730	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	21318260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	17804836, 19503088, 21156761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	GWASDB_DG	20526339		★★★★★ ★☆☆☆☆ Found in Text Mining only

RNF5 (ring finger protein 5)