Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	8737
Gene name	Receptor interacting serine/threonine kinase 1
Gene symbol	RIPK1
Synonyms (NCBI Gene)	AIEFLIMD57RIPRIP-1RIP1
Chromosome	6
Chromosome location	6p25.2
Summary	This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein plays a role in inflammation and cell death in response to tissue damage, pathogen recognition, and as part of development

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1561772403	G>-	Pathogenic, likely-pathogenic	Genic downstream transcript variant, coding sequence variant, frameshift variant

248

Show/Hide all (248)

miRTarBase ID	miRNA	Experiments
MIRT1307576	hsa-miR-1184	CLIP-seq
MIRT1307577	hsa-miR-1205	CLIP-seq
MIRT1307578	hsa-miR-1225-5p	CLIP-seq
MIRT1307579	hsa-miR-1236	CLIP-seq
MIRT1307580	hsa-miR-125a-3p	CLIP-seq
MIRT1307581	hsa-miR-1324	CLIP-seq
MIRT1307582	hsa-miR-204	CLIP-seq
MIRT1307583	hsa-miR-211	CLIP-seq
MIRT1307584	hsa-miR-3128	CLIP-seq
MIRT1307585	hsa-miR-3158-5p	CLIP-seq
MIRT1307586	hsa-miR-3185	CLIP-seq
MIRT1307587	hsa-miR-3189-5p	CLIP-seq
MIRT1307588	hsa-miR-3194-3p	CLIP-seq
MIRT1307589	hsa-miR-361-3p	CLIP-seq
MIRT1307590	hsa-miR-3672	CLIP-seq
MIRT1307591	hsa-miR-3934	CLIP-seq
MIRT1307592	hsa-miR-4261	CLIP-seq
MIRT1307593	hsa-miR-4287	CLIP-seq
MIRT1307594	hsa-miR-4323	CLIP-seq
MIRT1307595	hsa-miR-4417	CLIP-seq
MIRT1307596	hsa-miR-4469	CLIP-seq
MIRT1307597	hsa-miR-4496	CLIP-seq
MIRT1307598	hsa-miR-4536	CLIP-seq
MIRT1307599	hsa-miR-4685-3p	CLIP-seq
MIRT1307600	hsa-miR-4700-3p	CLIP-seq
MIRT1307601	hsa-miR-4726-3p	CLIP-seq
MIRT1307602	hsa-miR-4768-5p	CLIP-seq
MIRT1307603	hsa-miR-4786-5p	CLIP-seq
MIRT1307604	hsa-miR-4797-5p	CLIP-seq
MIRT1307605	hsa-miR-488	CLIP-seq
MIRT1307606	hsa-miR-496	CLIP-seq
MIRT1307607	hsa-miR-513a-3p	CLIP-seq
MIRT1307608	hsa-miR-541	CLIP-seq
MIRT1307609	hsa-miR-548n	CLIP-seq
MIRT1307610	hsa-miR-548t	CLIP-seq
MIRT1307611	hsa-miR-590-3p	CLIP-seq
MIRT1307612	hsa-miR-596	CLIP-seq
MIRT1307613	hsa-miR-654-5p	CLIP-seq
MIRT1307614	hsa-miR-764	CLIP-seq
MIRT1307615	hsa-miR-769-5p	CLIP-seq
MIRT1307616	hsa-miR-942	CLIP-seq
MIRT1307581	hsa-miR-1324	CLIP-seq
MIRT2091156	hsa-miR-1912	CLIP-seq
MIRT2091157	hsa-miR-198	CLIP-seq
MIRT2091158	hsa-miR-3121-5p	CLIP-seq
MIRT1307584	hsa-miR-3128	CLIP-seq
MIRT2091159	hsa-miR-3130-5p	CLIP-seq
MIRT2091160	hsa-miR-3138	CLIP-seq
MIRT2091161	hsa-miR-3168	CLIP-seq
MIRT2091162	hsa-miR-361-5p	CLIP-seq
MIRT1307590	hsa-miR-3672	CLIP-seq
MIRT2091163	hsa-miR-4325	CLIP-seq
MIRT1307596	hsa-miR-4469	CLIP-seq
MIRT2091164	hsa-miR-4482	CLIP-seq
MIRT2091165	hsa-miR-4690-3p	CLIP-seq
MIRT1307603	hsa-miR-4786-5p	CLIP-seq
MIRT2091166	hsa-miR-4793-3p	CLIP-seq
MIRT1307604	hsa-miR-4797-5p	CLIP-seq
MIRT2091167	hsa-miR-622	CLIP-seq
MIRT2091168	hsa-miR-759	CLIP-seq
MIRT1307615	hsa-miR-769-5p	CLIP-seq
MIRT1307616	hsa-miR-942	CLIP-seq
MIRT2315891	hsa-miR-1208	CLIP-seq
MIRT2315892	hsa-miR-141	CLIP-seq
MIRT2315893	hsa-miR-200a	CLIP-seq
MIRT2315894	hsa-miR-3065-5p	CLIP-seq
MIRT2315895	hsa-miR-3124-3p	CLIP-seq
MIRT2315896	hsa-miR-3150a-3p	CLIP-seq
MIRT2315897	hsa-miR-3155	CLIP-seq
MIRT2315898	hsa-miR-3155b	CLIP-seq
MIRT2315899	hsa-miR-3175	CLIP-seq
MIRT2315900	hsa-miR-3180	CLIP-seq
MIRT2315901	hsa-miR-3180-3p	CLIP-seq
MIRT2315902	hsa-miR-3196	CLIP-seq
MIRT2091162	hsa-miR-361-5p	CLIP-seq
MIRT2315903	hsa-miR-3679-3p	CLIP-seq
MIRT2315904	hsa-miR-371b-3p	CLIP-seq
MIRT2315905	hsa-miR-3925-3p	CLIP-seq
MIRT2315906	hsa-miR-4267	CLIP-seq
MIRT2315907	hsa-miR-4492	CLIP-seq
MIRT2315908	hsa-miR-4498	CLIP-seq
MIRT2315909	hsa-miR-4505	CLIP-seq
MIRT2315910	hsa-miR-4667-5p	CLIP-seq
MIRT2315911	hsa-miR-4685-5p	CLIP-seq
MIRT2091165	hsa-miR-4690-3p	CLIP-seq
MIRT2315912	hsa-miR-4700-5p	CLIP-seq
MIRT2315913	hsa-miR-4731-5p	CLIP-seq
MIRT2315914	hsa-miR-4749-3p	CLIP-seq
MIRT2315915	hsa-miR-4786-3p	CLIP-seq
MIRT1307604	hsa-miR-4797-5p	CLIP-seq
MIRT2315916	hsa-miR-484	CLIP-seq
MIRT2315917	hsa-miR-510	CLIP-seq
MIRT2315918	hsa-miR-591	CLIP-seq
MIRT2315919	hsa-miR-642a	CLIP-seq
MIRT2315920	hsa-miR-671-5p	CLIP-seq
MIRT2315921	hsa-miR-762	CLIP-seq
MIRT2315922	hsa-miR-766	CLIP-seq
MIRT2315923	hsa-miR-939	CLIP-seq
MIRT2393774	hsa-miR-101	CLIP-seq
MIRT2393775	hsa-miR-128	CLIP-seq
MIRT2393776	hsa-miR-1587	CLIP-seq
MIRT2393777	hsa-miR-27a	CLIP-seq
MIRT2393778	hsa-miR-27b	CLIP-seq
MIRT2393779	hsa-miR-3161	CLIP-seq
MIRT1307586	hsa-miR-3185	CLIP-seq
MIRT2393780	hsa-miR-3591-3p	CLIP-seq
MIRT2315907	hsa-miR-4492	CLIP-seq
MIRT2315908	hsa-miR-4498	CLIP-seq
MIRT2393781	hsa-miR-4656	CLIP-seq
MIRT2393782	hsa-miR-4672	CLIP-seq
MIRT2393783	hsa-miR-4675	CLIP-seq
MIRT2393784	hsa-miR-4741	CLIP-seq
MIRT1307604	hsa-miR-4797-5p	CLIP-seq
MIRT2393785	hsa-miR-513a-5p	CLIP-seq
MIRT2315921	hsa-miR-762	CLIP-seq
MIRT2315895	hsa-miR-3124-3p	CLIP-seq
MIRT2442567	hsa-miR-3127-3p	CLIP-seq
MIRT2442568	hsa-miR-3189-3p	CLIP-seq
MIRT2442569	hsa-miR-3619-3p	CLIP-seq
MIRT2315903	hsa-miR-3679-3p	CLIP-seq
MIRT2442570	hsa-miR-4446-5p	CLIP-seq
MIRT2442571	hsa-miR-4535	CLIP-seq
MIRT2442572	hsa-miR-4776-5p	CLIP-seq
MIRT2442573	hsa-miR-502-5p	CLIP-seq
MIRT2393774	hsa-miR-101	CLIP-seq
MIRT1307576	hsa-miR-1184	CLIP-seq
MIRT1307577	hsa-miR-1205	CLIP-seq
MIRT1307578	hsa-miR-1225-5p	CLIP-seq
MIRT2611957	hsa-miR-1254	CLIP-seq
MIRT2611958	hsa-miR-127-3p	CLIP-seq
MIRT2393775	hsa-miR-128	CLIP-seq
MIRT2611959	hsa-miR-1301	CLIP-seq
MIRT2611960	hsa-miR-136	CLIP-seq
MIRT2611961	hsa-miR-1470	CLIP-seq
MIRT2393776	hsa-miR-1587	CLIP-seq
MIRT2611962	hsa-miR-191	CLIP-seq
MIRT2611963	hsa-miR-1914	CLIP-seq
MIRT2091157	hsa-miR-198	CLIP-seq
MIRT1307582	hsa-miR-204	CLIP-seq
MIRT1307583	hsa-miR-211	CLIP-seq
MIRT2611964	hsa-miR-219-1-3p	CLIP-seq
MIRT2393777	hsa-miR-27a	CLIP-seq
MIRT2393778	hsa-miR-27b	CLIP-seq
MIRT2611965	hsa-miR-28-5p	CLIP-seq
MIRT2611966	hsa-miR-297	CLIP-seq
MIRT2611967	hsa-miR-3116	CLIP-seq
MIRT2611968	hsa-miR-3127-5p	CLIP-seq
MIRT1307584	hsa-miR-3128	CLIP-seq
MIRT2611969	hsa-miR-3139	CLIP-seq
MIRT1307585	hsa-miR-3158-5p	CLIP-seq
MIRT2611970	hsa-miR-3160-3p	CLIP-seq
MIRT2611971	hsa-miR-3184	CLIP-seq
MIRT1307587	hsa-miR-3189-5p	CLIP-seq
MIRT1307588	hsa-miR-3194-3p	CLIP-seq
MIRT2611972	hsa-miR-3202	CLIP-seq
MIRT2611973	hsa-miR-338-3p	CLIP-seq
MIRT2611974	hsa-miR-346	CLIP-seq
MIRT2611975	hsa-miR-3614-5p	CLIP-seq
MIRT2611976	hsa-miR-3647-3p	CLIP-seq
MIRT2611977	hsa-miR-3650	CLIP-seq
MIRT1307590	hsa-miR-3672	CLIP-seq
MIRT2611978	hsa-miR-3921	CLIP-seq
MIRT2611979	hsa-miR-423-5p	CLIP-seq
MIRT2611980	hsa-miR-4254	CLIP-seq
MIRT1307593	hsa-miR-4287	CLIP-seq
MIRT2611981	hsa-miR-4288	CLIP-seq
MIRT1307594	hsa-miR-4323	CLIP-seq
MIRT2611982	hsa-miR-4450	CLIP-seq
MIRT2611983	hsa-miR-4455	CLIP-seq
MIRT1307596	hsa-miR-4469	CLIP-seq
MIRT2611984	hsa-miR-4487	CLIP-seq
MIRT2315907	hsa-miR-4492	CLIP-seq
MIRT2611985	hsa-miR-4493	CLIP-seq
MIRT2315908	hsa-miR-4498	CLIP-seq
MIRT2611986	hsa-miR-4517	CLIP-seq
MIRT2611987	hsa-miR-4530	CLIP-seq
MIRT2611988	hsa-miR-4533	CLIP-seq
MIRT2611989	hsa-miR-4539	CLIP-seq
MIRT2611990	hsa-miR-4653-5p	CLIP-seq
MIRT2393781	hsa-miR-4656	CLIP-seq
MIRT2611991	hsa-miR-4660	CLIP-seq
MIRT2611992	hsa-miR-4667-3p	CLIP-seq
MIRT2611993	hsa-miR-4674	CLIP-seq
MIRT2393783	hsa-miR-4675	CLIP-seq
MIRT2611994	hsa-miR-4679	CLIP-seq
MIRT1307599	hsa-miR-4685-3p	CLIP-seq
MIRT2611995	hsa-miR-4711-3p	CLIP-seq
MIRT2611996	hsa-miR-4713-5p	CLIP-seq
MIRT2611997	hsa-miR-4733-5p	CLIP-seq
MIRT2393784	hsa-miR-4741	CLIP-seq
MIRT2315914	hsa-miR-4749-3p	CLIP-seq
MIRT1307603	hsa-miR-4786-5p	CLIP-seq
MIRT2611998	hsa-miR-4792	CLIP-seq
MIRT1307604	hsa-miR-4797-5p	CLIP-seq
MIRT1307606	hsa-miR-496	CLIP-seq
MIRT2611999	hsa-miR-5047	CLIP-seq
MIRT2393785	hsa-miR-513a-5p	CLIP-seq
MIRT2612000	hsa-miR-513b	CLIP-seq
MIRT2612001	hsa-miR-545	CLIP-seq
MIRT2612002	hsa-miR-558	CLIP-seq
MIRT2612003	hsa-miR-567	CLIP-seq
MIRT2612004	hsa-miR-593	CLIP-seq
MIRT1307612	hsa-miR-596	CLIP-seq
MIRT2612005	hsa-miR-627	CLIP-seq
MIRT2612006	hsa-miR-632	CLIP-seq
MIRT2612007	hsa-miR-640	CLIP-seq
MIRT2612008	hsa-miR-708	CLIP-seq
MIRT2091168	hsa-miR-759	CLIP-seq
MIRT2315921	hsa-miR-762	CLIP-seq
MIRT2315922	hsa-miR-766	CLIP-seq
MIRT1307615	hsa-miR-769-5p	CLIP-seq
MIRT1307576	hsa-miR-1184	CLIP-seq
MIRT1307577	hsa-miR-1205	CLIP-seq
MIRT1307580	hsa-miR-125a-3p	CLIP-seq
MIRT2091157	hsa-miR-198	CLIP-seq
MIRT2611966	hsa-miR-297	CLIP-seq
MIRT2611968	hsa-miR-3127-5p	CLIP-seq
MIRT1307584	hsa-miR-3128	CLIP-seq
MIRT1307585	hsa-miR-3158-5p	CLIP-seq
MIRT1307587	hsa-miR-3189-5p	CLIP-seq
MIRT1307588	hsa-miR-3194-3p	CLIP-seq
MIRT2611972	hsa-miR-3202	CLIP-seq
MIRT2611974	hsa-miR-346	CLIP-seq
MIRT1307589	hsa-miR-361-3p	CLIP-seq
MIRT2611975	hsa-miR-3614-5p	CLIP-seq
MIRT2611977	hsa-miR-3650	CLIP-seq
MIRT1307590	hsa-miR-3672	CLIP-seq
MIRT1307591	hsa-miR-3934	CLIP-seq
MIRT2611981	hsa-miR-4288	CLIP-seq
MIRT1307594	hsa-miR-4323	CLIP-seq
MIRT1307595	hsa-miR-4417	CLIP-seq
MIRT2611983	hsa-miR-4455	CLIP-seq
MIRT2611985	hsa-miR-4493	CLIP-seq
MIRT2611988	hsa-miR-4533	CLIP-seq
MIRT2611995	hsa-miR-4711-3p	CLIP-seq
MIRT1307601	hsa-miR-4726-3p	CLIP-seq
MIRT2611997	hsa-miR-4733-5p	CLIP-seq
MIRT1307603	hsa-miR-4786-5p	CLIP-seq
MIRT1307604	hsa-miR-4797-5p	CLIP-seq
MIRT1307608	hsa-miR-541	CLIP-seq
MIRT2612003	hsa-miR-567	CLIP-seq
MIRT1307612	hsa-miR-596	CLIP-seq
MIRT2612005	hsa-miR-627	CLIP-seq
MIRT2612006	hsa-miR-632	CLIP-seq
MIRT1307613	hsa-miR-654-5p	CLIP-seq
MIRT2091168	hsa-miR-759	CLIP-seq
MIRT1307614	hsa-miR-764	CLIP-seq
MIRT1307615	hsa-miR-769-5p	CLIP-seq

124

Show/Hide all (124)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IMP	17389591
GO:0004672	Function	Protein kinase activity	IDA	15001576, 22265413
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	IMP	22817896
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	8612133, 23473668
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IMP	30988283, 31827280
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004706	Function	JUN kinase kinase kinase activity	IBA
GO:0005123	Function	Death receptor binding	IEA
GO:0005123	Function	Death receptor binding	IPI	7538908
GO:0005515	Function	Protein binding	IPI	10356400, 12884866, 12887920, 14653779, 16127453, 16611992, 17047155, 17389591, 17449468, 18022363, 18029035, 18067272, 18485876, 19060883, 19524512, 19524513, 19781631, 21383699, 21458669, 21525013, 21810480, 21887730, 21931591, 22173242, 22265413, 22265414, 22274400, 22817896, 231
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	16507998
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IMP	21737330, 22891283, 29440439
GO:0006954	Process	Inflammatory response	IEA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0006979	Process	Response to oxidative stress	IMP	20550618
GO:0007165	Process	Signal transduction	IEA
GO:0007249	Process	Canonical NF-kappaB signal transduction	IMP	8612133
GO:0010008	Component	Endosome membrane	TAS
GO:0010628	Process	Positive regulation of gene expression	IDA	26020802
GO:0012501	Process	Programmed cell death	IEA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030163	Process	Protein catabolic process	IDA	17389591
GO:0031264	Component	Death-inducing signaling complex	IDA	11101870
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	18450452
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	16127453
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	16127453
GO:0032991	Component	Protein-containing complex	IDA	22817896
GO:0032991	Component	Protein-containing complex	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IC	8612133
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IEA
GO:0034612	Process	Response to tumor necrosis factor	IMP	10521396
GO:0035556	Process	Intracellular signal transduction	IDA	26020802
GO:0035591	Function	Signaling adaptor activity	IEA
GO:0036289	Process	Peptidyl-serine autophosphorylation	IDA	23473668
GO:0036289	Process	Peptidyl-serine autophosphorylation	IMP	31827280
GO:0042327	Process	Positive regulation of phosphorylation	IEA
GO:0042802	Function	Identical protein binding	IPI	22817896, 23473668, 25416956, 32296183
GO:0042803	Function	Protein homodimerization activity	IDA	29440439
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	8612133, 17389591
GO:0043065	Process	Positive regulation of apoptotic process	IMP	22173242
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0043068	Process	Positive regulation of programmed cell death	IMP	16611992
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	17389591
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	10521396
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IMP	17047155
GO:0043235	Component	Receptor complex	IDA	8612133
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0044877	Function	Protein-containing complex binding	IDA	22265414
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045651	Process	Positive regulation of macrophage differentiation	IMP	17047155
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16127453, 17389591
GO:0046330	Process	Positive regulation of JNK cascade	IDA	17389591
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0046777	Process	Protein autophosphorylation	IMP	29440439
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IMP	31827280
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	21931591
GO:0060544	Process	Regulation of necroptotic process	IEA
GO:0060545	Process	Positive regulation of necroptotic process	IEA
GO:0060545	Process	Positive regulation of necroptotic process	IMP	22028622, 22274400, 22817896
GO:0060546	Process	Negative regulation of necroptotic process	IEA
GO:0060546	Process	Negative regulation of necroptotic process	ISS
GO:0062100	Process	Positive regulation of programmed necrotic cell death	IMP	20550618
GO:0070105	Process	Positive regulation of interleukin-6-mediated signaling pathway	IEA
GO:0070105	Process	Positive regulation of interleukin-6-mediated signaling pathway	IMP	31827280
GO:0070231	Process	T cell apoptotic process	IEA
GO:0070231	Process	T cell apoptotic process	ISS
GO:0070266	Process	Necroptotic process	IEA
GO:0070266	Process	Necroptotic process	IMP	21737330, 22265414, 29440439, 30988283
GO:0070266	Process	Necroptotic process	ISS
GO:0070266	Process	Necroptotic process	TAS
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	ISS
GO:0070513	Function	Death domain binding	IPI	8612133, 9044836
GO:0071356	Process	Cellular response to tumor necrosis factor	IDA	17389591
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	7538908
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IMP	8612133, 10521396
GO:0097300	Process	Programmed necrotic cell death	IEA
GO:0097300	Process	Programmed necrotic cell death	ISS
GO:0097342	Component	Ripoptosome	IDA	21737330
GO:0097343	Process	Ripoptosome assembly	IEA
GO:0097343	Process	Ripoptosome assembly	IMP	21737330
GO:0097527	Process	Necroptotic signaling pathway	IBA
GO:0097527	Process	Necroptotic signaling pathway	IEA
GO:0097527	Process	Necroptotic signaling pathway	IMP	11101870, 16507998, 22265413, 22817896, 31827280
GO:0097527	Process	Necroptotic signaling pathway	ISS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1900119	Process	Positive regulation of execution phase of apoptosis	IEA
GO:1901026	Process	Ripoptosome assembly involved in necroptotic process	IEA
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IEA
GO:1903265	Process	Positive regulation of tumor necrosis factor-mediated signaling pathway	IEA
GO:1903800	Process	Positive regulation of miRNA processing	IDA	26020802
GO:1990000	Process	Amyloid fibril formation	IMP	22817896
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	IEA
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	IEA
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	TAS	17979836
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IEA
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IEA
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IMP	21525013
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IEA
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IEA
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IMP	21525013, 22274400
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA

MIM	HGNC	e!Ensembl
603453	10019	ENSG00000137275

Q13546

Protein name

Receptor-interacting serine/threonine-protein kinase 1 (EC 2.7.11.1) (Cell death protein RIP) (Receptor-interacting protein 1) (RIP-1)

Protein function

Serine-threonine kinase which is a key regulator of TNF-mediated apoptosis, necroptosis and inflammatory pathways (PubMed:17703191, PubMed:24144979, PubMed:31827280, PubMed:31827281, PubMed:32657447, PubMed:35831301). Exhibits kinase activity-de

PDB

4ITH , 4ITI , 4ITJ , 4NEU , 5HX6 , 5TX5 , 5V7Z , 6AC5 , 6C3E , 6C4D , 6HHO , 6NW2 , 6NYH , 6OCQ , 6R5F , 6RLN , 7CJB , 7FCZ , 7FD0 , 7XMK , 7YDX , 8I2N

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07714	PK_Tyr_Ser-Thr	18 → 285	Protein tyrosine and serine/threonine kinase	Domain
PF12721	RHIM	504 → 549	RIP homotypic interaction motif	Family
PF00531	Death	584 → 669	Death domain	Domain

Sequence

MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEAL
LEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIIL
EIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVD
GTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMC
IKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEED
VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFA
PSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPF
AQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLD
PGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQ
IGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKN
CARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRID
LLSSLIYVSQN

Sequence length

671

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Autoinflammation with episodic fever and lymphadenopathy	Pathogenic	rs1760720617, rs1760720924	RCV001089772 RCV001089773 RCV001089774 RCV001089775	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hereditary breast ovarian cancer syndrome	Pathogenic	rs2113726155	RCV001374515	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
IL10-related early-onset inflammatory bowel disease	Likely pathogenic; Pathogenic	rs1561772403, rs374657927, rs1561780980, rs752183065	RCV000754605 RCV000754604 RCV000754606 RCV000754602	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Immunodeficiency 57	Pathogenic; Likely pathogenic	rs2113607375, rs1759915032, rs1759514836, rs1561772403	RCV003152783 RCV000680190 RCV000680191 RCV000985125	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Inborn error of immunity	Likely pathogenic; Pathogenic	rs1561772403, rs374657927, rs1561780980, rs752183065	RCV000754605 RCV000754604 RCV000754606 RCV000754602	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CRIA SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC OSTEONECROSIS OF THE FEMORAL HEAD	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNE DYSREGULATION, INFLAMMATORY BOWEL DISEASE, ARTHRITIS, RECURRENT INFECTION SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNE DYSREGULATION, INFLAMMATORY BOWEL DISEASE, ARTHRITIS, RECURRENT INFECTION, LYMPHOPENIA SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNE DYSREGULATION-INFLAMMATORY BOWEL DISEASE-ARTHRITIS-RECURRENT INFECTIONS-LYMPHOPENIA SYNDROME	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 57 WITH AUTOINFLAMMATION	—	Disgenet, HPO Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RIPK1-related disorder	Benign; Uncertain significance; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (198)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute pancreatitis	Pancreatitis	BEFREE	28300832, 31375658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	31661557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	28087739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	19629486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	30500363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	29681455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	27493188, 30146158, 30193106, 31013427, 31427374, 31437302, 31745214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	25563840, 28186202, 30842407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	35480868	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	30026316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	31101885, 31213653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16951485	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29212904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome Type 2B	Autoimmune Lymphoproliferative Disorder	BEFREE	29666472		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	16498450, 31561314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	26749282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29050220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17007882, 18641687, 20370918, 21383699, 23499682, 28404866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30808745, 36976201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22674009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	21282461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26261530, 26552967, 27699664, 28759952, 35264437, 35855852	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27738385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	34071938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27362805	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	25910754	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29247776, 29686306		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31212131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31212131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	31806991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	31914150, 33036630, 34083572, 37513508	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	31409605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestatic liver disease	Cholestatic liver disease	BEFREE	30988397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	30604633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	28454582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11166462		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	30467385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	26037070, 26982364, 29555502, 31837309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	36466854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25675296, 25906152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20567846, 25244939, 28087739, 29531160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25244939, 25906152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Combined immunodeficiency	Severe combined immunodeficiency disease	BEFREE	30591564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	30983519, 31806991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28454582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27362805, 31000693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	31685620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	31114134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28396243, 30604633, 31606726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	37098514	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	28647349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15240665, 17512546, 17615584, 28956297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15240665, 17512546, 17615584, 28956297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	17615584, 28861085, 29883690, 30623001, 31612266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	19918773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	19629486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	31806991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24959694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	24959694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30466110, 31760070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	22355661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30237126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	28069809, 30193106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	30622241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	25277242, 29844685, 31545498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	25277242	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	25416676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	30500363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	19339267, 19435890, 22469979, 25880091, 28404866, 29274253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19435890	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22585859, 25939870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19339267, 19435890, 22469979, 23972990, 25880091, 28404866, 29274253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19435890, 28108311, 28816233, 31819475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	40565018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	31213653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	20200450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	30500363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	28454582	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	11166462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	27699664	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	17615584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	14613923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	35716229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IMMUNODEFICIENCY 57	Immunodeficiency	GENOMICS_ENGLAND_DG	30026316		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
IMMUNODEFICIENCY 57	Immunodeficiency	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	31427374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30042663, 30356849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	26982364, 29089374, 30136236, 30591564, 30842600, 31427374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	30591564, 36466854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	28647349		★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	28288569, 30796198, 31661557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	26261530	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	31029152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	31213653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31055628, 31440386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	20393185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29500402, 29588419, 29860048, 31315969		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	27748372, 28461585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	33027529	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	27748372, 35165513, 35370472, 35873796	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	25144719, 27748372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27699664, 28017612, 28759952, 30588188, 31330233, 31429854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	31429854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	30446523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	28270653	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	28628031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	23633517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35775532, 37864090, 38126996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	29550813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20516030, 29550813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28759952	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	29844685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Primary Cutaneous Anaplastic Large Cell	Primary cutaneous anaplastic large cell lymphoma	Pubtator	23545938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17007882, 18641687, 20370918, 21383699, 23499682, 28404866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24959694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	25277242, 29844685, 31545498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	26261530, 28017612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27738385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17512546, 18253734, 29312502, 29464045, 30423296, 31223438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26516927, 26921446, 29050220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27035122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21822305, 23633517, 24425875, 25277242, 25724678, 26446169, 27129149, 28159673, 28628031, 29531160, 29535128, 30455045, 30610617, 31223438, 31235688, 31806991 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31212131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25675296, 25906152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19632771, 26749282, 31521607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	11468180		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25724678, 29350287, 29706658, 30850732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	26018731, 29880840, 34072104, 34638912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	39905300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	19362737, 40508046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28295550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	23595117, 25801023, 31611942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	30413413		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	30413413, 31719677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	31719677, 34563605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	11166462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	26038570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	31106003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	16507998, 16611992, 22421439, 23868066, 24832602, 25412314, 25906152, 29880840, 33132435, 34668777, 34804194, 37217473, 38007509	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	28710417	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12086877, 14613923, 17512546, 19401451, 19435890, 20438712, 21124841, 24507727, 25244939, 25277242, 26749282, 27035122, 27129149, 28087739, 28410990 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30392741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	26575016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	26575016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29681455, 31048504, 31506635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	29259007, 30796198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C1	Sphingomyelinase deficiency	BEFREE	26986514, 30392741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30466110, 31760070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23456625, 23633517, 30314898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	28978813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	20370918, 28933271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	30604633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27129149, 29229388, 29859193, 31044561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26247722, 27050456, 28159673, 28498503	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	17512546, 18253734, 29312502, 29464045, 30423296, 31223438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic diseases	Pubtator	18056257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Endocrine Carcinoma	Pancreatic Endocrine Carcinoma	BEFREE	31239269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	18253734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30038429, 34462421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	30413413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	28288569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31506635, 31591470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	30423296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyneuropathies	Polyneuropathy	Pubtator	40508046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	30024306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary immune deficiency disorder	immunodeficiency	CLINVAR_DG	30591564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary immune deficiency disorder	immunodeficiency	BEFREE	31213653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26516927, 26921446, 29050220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17448597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25412314, 35965682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29661487, 31013427, 31427374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	29661487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	28466458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28466458, 31000693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	31315969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	22927431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30339841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	36050939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	31771290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30735454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	30096906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	25910754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22674009, 23313255, 26992898, 37443802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23313255, 26992898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29729104, 31760070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27035122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31739592	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28579326, 28744127, 31370690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26733177, 27476169, 29021293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26733177, 27476169, 37217473	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29496522, 31427374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	32272907, 40289006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	30372886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	31974624, 34102211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RIPK1 (receptor interacting serine/threonine kinase 1)