RIN3 (Ras and Rab interactor 3)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 79890
• Gene name: Ras and Rab interactor 3
• Gene symbol: RIN3
• Synonyms (NCBI Gene): -
• Chromosome: 14
• Chromosome location: 14q32.12
• Summary: Summary: This protein encoded by this gene is a member of the RIN family of Ras interaction-interference proteins, which are binding partners to the RAB5 small GTPases. The protein functions as a guanine nucleotide exchange for RAB5B and RAB31. Alternativ

miRNA Show/Hide all (53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT491628	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT491626	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT491625	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT491624	hsa-miR-5194	PAR-CLIP	23592263
MIRT491623	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT491622	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT491621	hsa-miR-4710	PAR-CLIP	23592263
MIRT491620	hsa-miR-6734-5p	PAR-CLIP	23592263
MIRT491628	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT491626	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT491625	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT491624	hsa-miR-5194	PAR-CLIP	23592263
MIRT491623	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT491622	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT491621	hsa-miR-4710	PAR-CLIP	23592263
MIRT491620	hsa-miR-6734-5p	PAR-CLIP	23592263
MIRT1307300	hsa-miR-2110	CLIP-seq
MIRT1307301	hsa-miR-22	CLIP-seq
MIRT1307302	hsa-miR-28-5p	CLIP-seq
MIRT1307303	hsa-miR-3139	CLIP-seq
MIRT1307304	hsa-miR-3150b-3p	CLIP-seq
MIRT1307305	hsa-miR-3184	CLIP-seq
MIRT1307306	hsa-miR-3197	CLIP-seq
MIRT1307307	hsa-miR-4271	CLIP-seq
MIRT1307308	hsa-miR-4300	CLIP-seq
MIRT1307309	hsa-miR-4488	CLIP-seq
MIRT1307310	hsa-miR-4633-3p	CLIP-seq
MIRT1307311	hsa-miR-4667-5p	CLIP-seq
MIRT1307312	hsa-miR-4689	CLIP-seq
MIRT1307313	hsa-miR-4697-5p	CLIP-seq
MIRT1307314	hsa-miR-4700-5p	CLIP-seq
MIRT1307315	hsa-miR-4706	CLIP-seq
MIRT1307316	hsa-miR-4725-3p	CLIP-seq
MIRT1307317	hsa-miR-4734	CLIP-seq
MIRT1307318	hsa-miR-4749-5p	CLIP-seq
MIRT1307319	hsa-miR-4784	CLIP-seq
MIRT1307320	hsa-miR-544b	CLIP-seq
MIRT1307321	hsa-miR-558	CLIP-seq
MIRT1307322	hsa-miR-610	CLIP-seq
MIRT1307323	hsa-miR-637	CLIP-seq
MIRT1307324	hsa-miR-661	CLIP-seq
MIRT1307325	hsa-miR-708	CLIP-seq
MIRT1307326	hsa-miR-744	CLIP-seq
MIRT1307327	hsa-miR-920	CLIP-seq
MIRT2091089	hsa-miR-2278	CLIP-seq
MIRT2091090	hsa-miR-3155	CLIP-seq
MIRT2091091	hsa-miR-3155b	CLIP-seq
MIRT2091092	hsa-miR-4299	CLIP-seq
MIRT2091093	hsa-miR-4456	CLIP-seq
MIRT2091094	hsa-miR-4690-5p	CLIP-seq
MIRT2091095	hsa-miR-484	CLIP-seq
MIRT2091096	hsa-miR-548q	CLIP-seq
MIRT2091097	hsa-miR-760	CLIP-seq

Gene ontology (GO) Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002091	Process	Negative regulation of receptor internalization	IMP	23185384
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IMP	21586568, 23185384
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	TAS
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	17474147, 23185384, 25814554, 32552912, 35271311
GO:0005737	Component	Cytoplasm	IDA	18486601
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	21586568
GO:0005769	Component	Early endosome	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0006897	Process	Endocytosis	NAS	11733506
GO:0007165	Process	Signal transduction	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0030139	Component	Endocytic vesicle	IBA
GO:0030139	Component	Endocytic vesicle	IDA	18486601
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS	32552912
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS	32552912
GO:0031267	Function	Small GTPase binding	IBA
GO:0031267	Function	Small GTPase binding	IDA	21586568
GO:0031267	Function	Small GTPase binding	TAS	18486601
GO:0031410	Component	Cytoplasmic vesicle	IDA	21586568
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031982	Component	Vesicle	IDA	32552912
GO:0043025	Component	Neuronal cell body	IEA
GO:0043025	Component	Neuronal cell body	ISS	32552912
GO:0060755	Process	Negative regulation of mast cell chemotaxis	IMP	23185384
GO:0097494	Process	Regulation of vesicle size	IDA	32552912

Other IDs

• MIM: 610223
• HGNC: 18751
• e!Ensembl: ENSG00000100599

Protein

• UniProt ID: Q8TB24
• Protein name: Ras and Rab interactor 3 (Ras interaction/interference protein 3)
• Protein function: Ras effector protein that functions as a guanine nucleotide exchange (GEF) for RAB5B and RAB31, by exchanging bound GDP for free GTP. Required for normal RAB31 function.
• PDB: 3U23 , 4WCI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02204	VPS9	739 → 842	Vacuolar sorting protein 9 (VPS9) domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:12972505}.
• Sequence:

  MIRHAGAPARGDPTGPVPVVGKGEEEEEEDGMRLCLPANPKNCLPHRRGISILEKLIKTC
  PVWLQLSLGQAEVARILHRVVAGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIKEE
  KSILYLEGSALVFEDIFRLIAFYCVSRDLLPFTLRLPQAILEASSFTDLETIANLGLGFW
  DSSLNPPQERGKPAEPPRDRAPGFPLVSSLRPTAHDANCACEIELSVGNDRLWFVNPIFI
  EDCSSALPTDQPPLGNCPARPLPPTSDATSPTSRWAPRRPPPPPPVLPLQPCSPAQPPVL
  PALAPAPACPLPTSPPVPAPHVTPHAPGPPDHPNQPPMMTCERLPCPTAGLGPLREEAMK
  PGAASSPLQQVPAPPLPAKKNLPTAPPRRRVSERVSLEDQSPGMAAEGDQLSLPPQGTSD
  GPEDTPRESTEQGQDTEVKASDPHSMPELPRTAKQPPVPPPRKKRISRQLASTLPAPLEN
  AELCTQAMALETPTPGPPREGQSPASQAGTQHPPAQATAHSQSSPEFKGSLASLSDSLGV
  SVMATDQDSYSTSSTEEELEQFSSPSVKKKPSMILGKARHRLSFASFSSMFHAFLSNNRK
  LYKKVVELAQDKGSYFGSLVQDYKVYSLEMMARQTSSTEMLQEIRTMMTQLKSYLLQSTE
  LKALVDPALHSEEELEAIVESALYKCVLKPLKEAINSCLHQIHSKDGSLQQLKENQLVIL
  ATTTTDLGVTTSVPEVPMMEKILQKFTSMHKAYSPEKKISILLKTCKLIYDSMALGNPGK
  PYGADDFLPVLMYVLARSNLTEMLLNVEYMMELMDPALQLGEGSYYLTTTYGALEHIKSY
  DKITVTRQLSVEVQDSIHRWERRRTLNKARASRSSVQDFICVSYLEPEQQARTLASRADT
  QAQALCAQCAEKFAVERPQAHRLFVLVDGRCFQLADDALPHCIKGYLLRSEPKRDFHFVY
  RPLDGGGGGGGGSPPCLVVREPNFL

• Sequence length: 985

Pathways

Reactome Pathway:

RAB GEFs exchange GTP for GDP on RABs

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (22)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	35851147	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	32296059, 41213931	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-CELL ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	38616254	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	34033851	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	25751625, 29059683, 32139696, 36819030	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	25751625, 29058716, 29059683, 32139696	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	21546767	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	24621683, 25101718, 28166215, 30804561, 30940143, 33909500, 37069358	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	33632709	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	36914876, 40262193	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	29058716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	35851147	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung adenocarcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	36819030	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	36819030	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	34033851, 38616254	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	38965376	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	35470158	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RIN3-related disorder	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	27927641	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	32438682	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (20)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	28199971, 30258121, 30830563, 33419465, 33794991, 35090342, 35241726, 36411364, 37322917	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	28738127		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	33419465	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	17156400	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	28199971, 37322917	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	37322917	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	30830563		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	30830563	Associate	★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	30830563	Associate	★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	30830563		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	26635082	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	23185384	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28445147		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28445147	Associate	★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	CTD_human_DG	21623375		★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	24945404, 25701875, 30726512		★☆☆☆☆ Found in Text Mining only
Paget Disease	Paget disease	BEFREE	24945404, 25701875		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	30830563		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	25171373, 37422806	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	30830563	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

CAPSL 4 shared diseasesB-cell acute lymphoblastic leukemia, Biliary cirrhosis, Biliary cholangitis, Respiratory system disease 4 shared evidence sourcesGWAS catalog (B-cell acute lymphoblastic leukemia), GWAS catalog (Biliary cirrhosis), GWAS catalog (Biliary cholangitis), GWAS catalog (Respiratory system disease) Related via 4 shared diseases including B-cell acute lymphoblastic leukemia, Biliary cirrhosis — evidence mostly GWAS catalog. CD58 3 shared diseasesB-cell acute lymphoblastic leukemia, Biliary cirrhosis, Biliary cholangitis 3 shared evidence sourcesGWAS catalog (B-cell acute lymphoblastic leukemia), GWAS catalog (Biliary cirrhosis), GWAS catalog (Biliary cholangitis) Related via 3 shared diseases including B-cell acute lymphoblastic leukemia, Biliary cirrhosis — evidence mostly GWAS catalog. C1orf53 2 shared diseasesBiliary cirrhosis, Biliary cholangitis 3 shared evidence sourcesGWAS catalog (Biliary cirrhosis), GWAS catalog (Endometriosis), GWAS catalog (Biliary cholangitis) Related via 2 shared diseases including Biliary cirrhosis, Biliary cholangitis — evidence mostly GWAS catalog. ITGB8 3 shared diseasesBiliary cirrhosis, Biliary cholangitis, Respiratory system disease 4 shared evidence sourcesGWAS catalog (Biliary cirrhosis), GWAS catalog (Endometriosis), GWAS catalog (Biliary cholangitis), GWAS catalog (Respiratory system disease) Related via 3 shared diseases including Biliary cirrhosis, Biliary cholangitis — evidence mostly GWAS catalog. EBLN1 2 shared diseasesB-cell acute lymphoblastic leukemia, Biliary cholangitis 2 shared evidence sourcesGWAS catalog (B-cell acute lymphoblastic leukemia), GWAS catalog (Biliary cholangitis) Related via 2 shared diseases including B-cell acute lymphoblastic leukemia, Biliary cholangitis — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CAPSL	4	["B-cell acute lymphoblastic leukemia","Biliary cirrhosis","Biliary cholangitis","Respiratory system disease"]	0	[]	4	["GWAS catalog (B-cell acute lymphoblastic leukemia)","GWAS catalog (Biliary cirrhosis)","GWAS catalog (Biliary cholangitis)","GWAS catalog (Respiratory system disease)"]
CD58	3	["B-cell acute lymphoblastic leukemia","Biliary cirrhosis","Biliary cholangitis"]	0	[]	3	["GWAS catalog (B-cell acute lymphoblastic leukemia)","GWAS catalog (Biliary cirrhosis)","GWAS catalog (Biliary cholangitis)"]
C1orf53	2	["Biliary cirrhosis","Biliary cholangitis"]	0	[]	3	["GWAS catalog (Biliary cirrhosis)","GWAS catalog (Endometriosis)","GWAS catalog (Biliary cholangitis)"]
ITGB8	3	["Biliary cirrhosis","Biliary cholangitis","Respiratory system disease"]	0	[]	4	["GWAS catalog (Biliary cirrhosis)","GWAS catalog (Endometriosis)","GWAS catalog (Biliary cholangitis)","GWAS catalog (Respiratory system disease)"]
EBLN1	2	["B-cell acute lymphoblastic leukemia","Biliary cholangitis"]	0	[]	2	["GWAS catalog (B-cell acute lymphoblastic leukemia)","GWAS catalog (Biliary cholangitis)"]

Diseases Linked via Similar Genes

Eczema Linked via 2 of 5 related genesCAPSL, ITGB8 Systemic lupus erythematosus Linked via 2 of 5 related genesCAPSL, CD58 Diabetes mellitus type 1 Linked via 2 of 5 related genesCAPSL, ITGB8 Diabetes mellitus type 2 Linked via 2 of 5 related genesCAPSL, ITGB8 Multiple sclerosis Linked via 2 of 5 related genesCD58, EBLN1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Eczema	2	["CAPSL","ITGB8"]
Systemic lupus erythematosus	2	["CAPSL","CD58"]
Diabetes mellitus type 1	2	["CAPSL","ITGB8"]
Diabetes mellitus type 2	2	["CAPSL","ITGB8"]
Multiple sclerosis	2	["CD58","EBLN1"]