Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	431704
Gene name	Regulator of G protein signaling 21
Gene symbol	RGS21
Synonyms (NCBI Gene)	-
Chromosome	1
Chromosome location	1q31.2
Summary	Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins are GTPase-activating proteins for Gi (see GNAI1; MIM 139310) and Gq (see GNAQ; MIM 600998) class G-alpha protei

25 Show/Hide all (25)

miRTarBase ID	miRNA	Experiments
MIRT1304326	hsa-miR-4436b-5p	CLIP-seq
MIRT1304327	hsa-miR-4474-5p	CLIP-seq
MIRT2090184	hsa-miR-340	CLIP-seq
MIRT2090185	hsa-miR-3940-5p	CLIP-seq
MIRT2090186	hsa-miR-4263	CLIP-seq
MIRT2090187	hsa-miR-4307	CLIP-seq
MIRT2090188	hsa-miR-4507	CLIP-seq
MIRT2090189	hsa-miR-4799-5p	CLIP-seq
MIRT2090190	hsa-miR-548ac	CLIP-seq
MIRT2090191	hsa-miR-548ae	CLIP-seq
MIRT2090192	hsa-miR-548aj	CLIP-seq
MIRT2090193	hsa-miR-548am	CLIP-seq
MIRT2090194	hsa-miR-548d-3p	CLIP-seq
MIRT2090195	hsa-miR-548x	CLIP-seq
MIRT2090196	hsa-miR-548z	CLIP-seq
MIRT2090197	hsa-miR-576-5p	CLIP-seq
MIRT2090198	hsa-miR-605	CLIP-seq
MIRT2090199	hsa-miR-629	CLIP-seq
MIRT2458142	hsa-miR-1245b-5p	CLIP-seq
MIRT2458143	hsa-miR-1304	CLIP-seq
MIRT2458144	hsa-miR-2355-5p	CLIP-seq
MIRT2458145	hsa-miR-3142	CLIP-seq
MIRT2458146	hsa-miR-3938	CLIP-seq
MIRT2458147	hsa-miR-4286	CLIP-seq
MIRT2458148	hsa-miR-4780	CLIP-seq

9 Show/Hide all (9)

GO ID	Ontology	Definition	Evidence
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0019226	Process	Transmission of nerve impulse	IEA
GO:0050913	Process	Sensory perception of bitter taste	IEA
GO:0050916	Process	Sensory perception of sweet taste	IEA
GO:0050917	Process	Sensory perception of umami taste	IEA

MIM	HGNC	e!Ensembl
612407	26839	ENSG00000253148

Q2M5E4

Protein name

Regulator of G-protein signaling 21 (RGS21)

Protein function

Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00615	RGS	21 → 136	Regulator of G protein signaling domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed ubiquitously. {ECO:0000269|PubMed:16302027}.

Sequence

MPVKCCFYRSPTAETMTWSENMDTLLANQAGLDAFRIFLKSEFSEENVEFWLACEDFKKT
KNADKIASKAKMIYSEFIEADAPKEINIDFGTRDLISKNIAEPTLKCFDEAQKLIYCLMA
KDSFPRFLKSEIYKKLVNSQQVPNHKKWLPFL

Sequence length

152

Interactions

View interactions

Reactome Pathway
G alpha (q) signalling events
G alpha (i) signalling events

RGS21 (regulator of G protein signaling 21)

Bookmark This Gene