RCC1 (regulator of chromosome condensation 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 1104
• Gene name: Regulator of chromosome condensation 1
• Gene symbol: RCC1
• Synonyms (NCBI Gene): CHC1, RCC1-I
• Chromosome: 1
• Chromosome location: 1p35.3

miRNA Show/Hide all (301)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016531	hsa-miR-193b-3p	Microarray	20304954
MIRT023213	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT049090	hsa-miR-92a-3p	CLASH	23622248
MIRT045518	hsa-miR-149-5p	CLASH	23622248
MIRT016531	hsa-miR-193b-3p	CLASH	23622248
MIRT040885	hsa-miR-18a-3p	CLASH	23622248
MIRT040885	hsa-miR-18a-3p	CLASH	23622248
MIRT036582	hsa-miR-941	CLASH	23622248
MIRT504132	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT504131	hsa-miR-5692a	PAR-CLIP	20371350
MIRT504130	hsa-miR-4310	PAR-CLIP	20371350
MIRT504129	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT504128	hsa-miR-1825	PAR-CLIP	20371350
MIRT504127	hsa-miR-199a-5p	PAR-CLIP	20371350
MIRT504126	hsa-miR-199b-5p	PAR-CLIP	20371350
MIRT504125	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT504124	hsa-miR-107	PAR-CLIP	20371350
MIRT504132	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT504131	hsa-miR-5692a	PAR-CLIP	20371350
MIRT504130	hsa-miR-4310	PAR-CLIP	20371350
MIRT504129	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT504128	hsa-miR-1825	PAR-CLIP	20371350
MIRT504127	hsa-miR-199a-5p	PAR-CLIP	20371350
MIRT504126	hsa-miR-199b-5p	PAR-CLIP	20371350
MIRT504125	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT504124	hsa-miR-107	PAR-CLIP	20371350
MIRT504132	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT504131	hsa-miR-5692a	PAR-CLIP	21572407
MIRT504130	hsa-miR-4310	PAR-CLIP	21572407
MIRT504129	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT554893	hsa-miR-5190	PAR-CLIP	21572407
MIRT504128	hsa-miR-1825	PAR-CLIP	21572407
MIRT504127	hsa-miR-199a-5p	PAR-CLIP	21572407
MIRT504126	hsa-miR-199b-5p	PAR-CLIP	21572407
MIRT504125	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT504124	hsa-miR-107	PAR-CLIP	21572407
MIRT504132	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT504131	hsa-miR-5692a	PAR-CLIP	21572407
MIRT504130	hsa-miR-4310	PAR-CLIP	21572407
MIRT504129	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT504128	hsa-miR-1825	PAR-CLIP	21572407
MIRT504127	hsa-miR-199a-5p	PAR-CLIP	21572407
MIRT504126	hsa-miR-199b-5p	PAR-CLIP	21572407
MIRT504125	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT504124	hsa-miR-107	PAR-CLIP	21572407
MIRT504132	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT504131	hsa-miR-5692a	PAR-CLIP	23446348
MIRT504130	hsa-miR-4310	PAR-CLIP	23446348
MIRT504129	hsa-miR-7157-5p	PAR-CLIP	23446348
MIRT504128	hsa-miR-1825	PAR-CLIP	23446348
MIRT504127	hsa-miR-199a-5p	PAR-CLIP	23446348
MIRT504126	hsa-miR-199b-5p	PAR-CLIP	23446348
MIRT504125	hsa-miR-103a-3p	PAR-CLIP	23446348
MIRT504124	hsa-miR-107	PAR-CLIP	23446348
MIRT504132	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT504131	hsa-miR-5692a	PAR-CLIP	20371350
MIRT504130	hsa-miR-4310	PAR-CLIP	20371350
MIRT504129	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT504128	hsa-miR-1825	PAR-CLIP	20371350
MIRT504127	hsa-miR-199a-5p	PAR-CLIP	20371350
MIRT504126	hsa-miR-199b-5p	PAR-CLIP	20371350
MIRT504125	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT504124	hsa-miR-107	PAR-CLIP	20371350
MIRT504132	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT504131	hsa-miR-5692a	PAR-CLIP	20371350
MIRT504130	hsa-miR-4310	PAR-CLIP	20371350
MIRT504129	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT504128	hsa-miR-1825	PAR-CLIP	20371350
MIRT504127	hsa-miR-199a-5p	PAR-CLIP	20371350
MIRT504126	hsa-miR-199b-5p	PAR-CLIP	20371350
MIRT504125	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT504124	hsa-miR-107	PAR-CLIP	20371350
MIRT504132	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT504131	hsa-miR-5692a	PAR-CLIP	21572407
MIRT504130	hsa-miR-4310	PAR-CLIP	21572407
MIRT504129	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT554893	hsa-miR-5190	PAR-CLIP	21572407
MIRT504128	hsa-miR-1825	PAR-CLIP	21572407
MIRT504127	hsa-miR-199a-5p	PAR-CLIP	21572407
MIRT504126	hsa-miR-199b-5p	PAR-CLIP	21572407
MIRT504125	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT504124	hsa-miR-107	PAR-CLIP	21572407
MIRT504132	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT504131	hsa-miR-5692a	PAR-CLIP	21572407
MIRT504130	hsa-miR-4310	PAR-CLIP	21572407
MIRT504129	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT504128	hsa-miR-1825	PAR-CLIP	21572407
MIRT504127	hsa-miR-199a-5p	PAR-CLIP	21572407
MIRT504126	hsa-miR-199b-5p	PAR-CLIP	21572407
MIRT504125	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT504124	hsa-miR-107	PAR-CLIP	21572407
MIRT504132	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT504131	hsa-miR-5692a	PAR-CLIP	23446348
MIRT504130	hsa-miR-4310	PAR-CLIP	23446348
MIRT504129	hsa-miR-7157-5p	PAR-CLIP	23446348
MIRT504128	hsa-miR-1825	PAR-CLIP	23446348
MIRT504127	hsa-miR-199a-5p	PAR-CLIP	23446348
MIRT504126	hsa-miR-199b-5p	PAR-CLIP	23446348
MIRT504125	hsa-miR-103a-3p	PAR-CLIP	23446348
MIRT504124	hsa-miR-107	PAR-CLIP	23446348
MIRT1297893	hsa-miR-1184	CLIP-seq
MIRT1297894	hsa-miR-1205	CLIP-seq
MIRT1297895	hsa-miR-1266	CLIP-seq
MIRT1297896	hsa-miR-128	CLIP-seq
MIRT1297897	hsa-miR-1301	CLIP-seq
MIRT1297898	hsa-miR-2113	CLIP-seq
MIRT1297899	hsa-miR-218	CLIP-seq
MIRT1297900	hsa-miR-3127-5p	CLIP-seq
MIRT1297901	hsa-miR-3150a-3p	CLIP-seq
MIRT1297902	hsa-miR-3158-5p	CLIP-seq
MIRT1297903	hsa-miR-3175	CLIP-seq
MIRT1297904	hsa-miR-3192	CLIP-seq
MIRT1297905	hsa-miR-34b	CLIP-seq
MIRT1297906	hsa-miR-3918	CLIP-seq
MIRT1297907	hsa-miR-4314	CLIP-seq
MIRT1297908	hsa-miR-4446-3p	CLIP-seq
MIRT1297909	hsa-miR-4492	CLIP-seq
MIRT1297910	hsa-miR-4498	CLIP-seq
MIRT1297911	hsa-miR-4505	CLIP-seq
MIRT1297912	hsa-miR-4518	CLIP-seq
MIRT1297913	hsa-miR-4646-5p	CLIP-seq
MIRT1297914	hsa-miR-4660	CLIP-seq
MIRT1297915	hsa-miR-4667-5p	CLIP-seq
MIRT1297916	hsa-miR-4700-5p	CLIP-seq
MIRT1297917	hsa-miR-4731-5p	CLIP-seq
MIRT1297918	hsa-miR-4747-3p	CLIP-seq
MIRT1297919	hsa-miR-4769-3p	CLIP-seq
MIRT1297920	hsa-miR-5047	CLIP-seq
MIRT1297921	hsa-miR-636	CLIP-seq
MIRT1297922	hsa-miR-642b	CLIP-seq
MIRT1297923	hsa-miR-668	CLIP-seq
MIRT1297924	hsa-miR-762	CLIP-seq
MIRT1297925	hsa-miR-939	CLIP-seq
MIRT1297895	hsa-miR-1266	CLIP-seq
MIRT1297896	hsa-miR-128	CLIP-seq
MIRT1297926	hsa-miR-1291	CLIP-seq
MIRT1297927	hsa-miR-3176	CLIP-seq
MIRT1297928	hsa-miR-326	CLIP-seq
MIRT1297929	hsa-miR-328	CLIP-seq
MIRT1297930	hsa-miR-330-5p	CLIP-seq
MIRT1297931	hsa-miR-3664-3p	CLIP-seq
MIRT1297932	hsa-miR-3664-5p	CLIP-seq
MIRT1297933	hsa-miR-3714	CLIP-seq
MIRT1297934	hsa-miR-3922-3p	CLIP-seq
MIRT1297935	hsa-miR-4290	CLIP-seq
MIRT1297936	hsa-miR-4436a	CLIP-seq
MIRT1297937	hsa-miR-4474-5p	CLIP-seq
MIRT1297912	hsa-miR-4518	CLIP-seq
MIRT1297938	hsa-miR-4759	CLIP-seq
MIRT1297939	hsa-miR-548an	CLIP-seq
MIRT1297940	hsa-miR-587	CLIP-seq
MIRT1297941	hsa-miR-593	CLIP-seq
MIRT1297922	hsa-miR-642b	CLIP-seq
MIRT1297942	hsa-miR-873	CLIP-seq
MIRT1297943	hsa-miR-940	CLIP-seq
MIRT1297893	hsa-miR-1184	CLIP-seq
MIRT1297894	hsa-miR-1205	CLIP-seq
MIRT1297895	hsa-miR-1266	CLIP-seq
MIRT2088502	hsa-miR-1268	CLIP-seq
MIRT2088503	hsa-miR-1268b	CLIP-seq
MIRT1297896	hsa-miR-128	CLIP-seq
MIRT2088504	hsa-miR-1285	CLIP-seq
MIRT2088505	hsa-miR-1286	CLIP-seq
MIRT2088506	hsa-miR-1294	CLIP-seq
MIRT2088507	hsa-miR-129-5p	CLIP-seq
MIRT1297897	hsa-miR-1301	CLIP-seq
MIRT2088508	hsa-miR-1321	CLIP-seq
MIRT2088509	hsa-miR-1470	CLIP-seq
MIRT2088510	hsa-miR-2115	CLIP-seq
MIRT2088511	hsa-miR-2355-3p	CLIP-seq
MIRT2088512	hsa-miR-3120-5p	CLIP-seq
MIRT2088513	hsa-miR-3124-3p	CLIP-seq
MIRT2088514	hsa-miR-3126-5p	CLIP-seq
MIRT1297900	hsa-miR-3127-5p	CLIP-seq
MIRT2088515	hsa-miR-3130-3p	CLIP-seq
MIRT1297901	hsa-miR-3150a-3p	CLIP-seq
MIRT1297902	hsa-miR-3158-5p	CLIP-seq
MIRT1297903	hsa-miR-3175	CLIP-seq
MIRT2088516	hsa-miR-3187-5p	CLIP-seq
MIRT1297928	hsa-miR-326	CLIP-seq
MIRT1297930	hsa-miR-330-5p	CLIP-seq
MIRT2088517	hsa-miR-339-5p	CLIP-seq
MIRT2088518	hsa-miR-378g	CLIP-seq
MIRT1297906	hsa-miR-3918	CLIP-seq
MIRT2088519	hsa-miR-3944-5p	CLIP-seq
MIRT2088520	hsa-miR-4257	CLIP-seq
MIRT2088521	hsa-miR-4316	CLIP-seq
MIRT2088522	hsa-miR-4326	CLIP-seq
MIRT2088523	hsa-miR-4419a	CLIP-seq
MIRT1297936	hsa-miR-4436a	CLIP-seq
MIRT1297908	hsa-miR-4446-3p	CLIP-seq
MIRT2088524	hsa-miR-4469	CLIP-seq
MIRT2088525	hsa-miR-4486	CLIP-seq
MIRT1297909	hsa-miR-4492	CLIP-seq
MIRT1297910	hsa-miR-4498	CLIP-seq
MIRT1297911	hsa-miR-4505	CLIP-seq
MIRT2088526	hsa-miR-450a	CLIP-seq
MIRT2088527	hsa-miR-4510	CLIP-seq
MIRT1297912	hsa-miR-4518	CLIP-seq
MIRT2088528	hsa-miR-4519	CLIP-seq
MIRT2088529	hsa-miR-4530	CLIP-seq
MIRT2088530	hsa-miR-4645-5p	CLIP-seq
MIRT2088531	hsa-miR-4646-3p	CLIP-seq
MIRT1297914	hsa-miR-4660	CLIP-seq
MIRT2088532	hsa-miR-4667-3p	CLIP-seq
MIRT1297915	hsa-miR-4667-5p	CLIP-seq
MIRT2088533	hsa-miR-4668-5p	CLIP-seq
MIRT2088534	hsa-miR-4673	CLIP-seq
MIRT2088535	hsa-miR-4677-3p	CLIP-seq
MIRT2088536	hsa-miR-4679	CLIP-seq
MIRT1297916	hsa-miR-4700-5p	CLIP-seq
MIRT2088537	hsa-miR-4722-5p	CLIP-seq
MIRT1297917	hsa-miR-4731-5p	CLIP-seq
MIRT2088538	hsa-miR-4739	CLIP-seq
MIRT1297918	hsa-miR-4747-3p	CLIP-seq
MIRT2088539	hsa-miR-4753-3p	CLIP-seq
MIRT2088540	hsa-miR-4755-3p	CLIP-seq
MIRT2088541	hsa-miR-4756-5p	CLIP-seq
MIRT1297919	hsa-miR-4769-3p	CLIP-seq
MIRT2088542	hsa-miR-4778-5p	CLIP-seq
MIRT2088543	hsa-miR-4786-3p	CLIP-seq
MIRT2088544	hsa-miR-4793-3p	CLIP-seq
MIRT1297920	hsa-miR-5047	CLIP-seq
MIRT2088545	hsa-miR-511	CLIP-seq
MIRT2088546	hsa-miR-515-3p	CLIP-seq
MIRT2088547	hsa-miR-516a-3p	CLIP-seq
MIRT2088548	hsa-miR-519e	CLIP-seq
MIRT2088549	hsa-miR-544	CLIP-seq
MIRT2088550	hsa-miR-585	CLIP-seq
MIRT1297941	hsa-miR-593	CLIP-seq
MIRT2088551	hsa-miR-612	CLIP-seq
MIRT1297922	hsa-miR-642b	CLIP-seq
MIRT1297923	hsa-miR-668	CLIP-seq
MIRT2088552	hsa-miR-670	CLIP-seq
MIRT1297924	hsa-miR-762	CLIP-seq
MIRT1297925	hsa-miR-939	CLIP-seq
MIRT1297895	hsa-miR-1266	CLIP-seq
MIRT1297896	hsa-miR-128	CLIP-seq
MIRT2088510	hsa-miR-2115	CLIP-seq
MIRT1297900	hsa-miR-3127-5p	CLIP-seq
MIRT1297901	hsa-miR-3150a-3p	CLIP-seq
MIRT1297903	hsa-miR-3175	CLIP-seq
MIRT2088517	hsa-miR-339-5p	CLIP-seq
MIRT1297931	hsa-miR-3664-3p	CLIP-seq
MIRT2313494	hsa-miR-3913-3p	CLIP-seq
MIRT1297906	hsa-miR-3918	CLIP-seq
MIRT2313495	hsa-miR-3919	CLIP-seq
MIRT2313496	hsa-miR-4330	CLIP-seq
MIRT1297936	hsa-miR-4436a	CLIP-seq
MIRT1297908	hsa-miR-4446-3p	CLIP-seq
MIRT2313497	hsa-miR-4481	CLIP-seq
MIRT1297909	hsa-miR-4492	CLIP-seq
MIRT1297910	hsa-miR-4498	CLIP-seq
MIRT1297911	hsa-miR-4505	CLIP-seq
MIRT1297912	hsa-miR-4518	CLIP-seq
MIRT1297915	hsa-miR-4667-5p	CLIP-seq
MIRT2088535	hsa-miR-4677-3p	CLIP-seq
MIRT2088536	hsa-miR-4679	CLIP-seq
MIRT2313498	hsa-miR-4693-3p	CLIP-seq
MIRT1297916	hsa-miR-4700-5p	CLIP-seq
MIRT1297917	hsa-miR-4731-5p	CLIP-seq
MIRT2313499	hsa-miR-4745-5p	CLIP-seq
MIRT1297918	hsa-miR-4747-3p	CLIP-seq
MIRT2088540	hsa-miR-4755-3p	CLIP-seq
MIRT2313500	hsa-miR-4756-3p	CLIP-seq
MIRT1297919	hsa-miR-4769-3p	CLIP-seq
MIRT2313501	hsa-miR-489	CLIP-seq
MIRT2313502	hsa-miR-499-3p	CLIP-seq
MIRT2313503	hsa-miR-499a-3p	CLIP-seq
MIRT2088547	hsa-miR-516a-3p	CLIP-seq
MIRT1297922	hsa-miR-642b	CLIP-seq
MIRT2088552	hsa-miR-670	CLIP-seq
MIRT1297924	hsa-miR-762	CLIP-seq
MIRT1297925	hsa-miR-939	CLIP-seq
MIRT1297895	hsa-miR-1266	CLIP-seq
MIRT1297896	hsa-miR-128	CLIP-seq
MIRT1297900	hsa-miR-3127-5p	CLIP-seq
MIRT1297901	hsa-miR-3150a-3p	CLIP-seq
MIRT1297903	hsa-miR-3175	CLIP-seq
MIRT1297906	hsa-miR-3918	CLIP-seq
MIRT1297936	hsa-miR-4436a	CLIP-seq
MIRT1297908	hsa-miR-4446-3p	CLIP-seq
MIRT1297909	hsa-miR-4492	CLIP-seq
MIRT1297910	hsa-miR-4498	CLIP-seq
MIRT1297911	hsa-miR-4505	CLIP-seq
MIRT1297912	hsa-miR-4518	CLIP-seq
MIRT1297915	hsa-miR-4667-5p	CLIP-seq
MIRT1297916	hsa-miR-4700-5p	CLIP-seq
MIRT1297917	hsa-miR-4731-5p	CLIP-seq
MIRT1297918	hsa-miR-4747-3p	CLIP-seq
MIRT1297922	hsa-miR-642b	CLIP-seq
MIRT1297924	hsa-miR-762	CLIP-seq
MIRT1297925	hsa-miR-939	CLIP-seq
MIRT2610175	hsa-miR-3188	CLIP-seq
MIRT2088520	hsa-miR-4257	CLIP-seq
MIRT2088540	hsa-miR-4755-3p	CLIP-seq
MIRT2088543	hsa-miR-4786-3p	CLIP-seq
MIRT2610175	hsa-miR-3188	CLIP-seq
MIRT2088520	hsa-miR-4257	CLIP-seq
MIRT2088540	hsa-miR-4755-3p	CLIP-seq
MIRT2088543	hsa-miR-4786-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MYC	Unknown	9178906

Gene ontology (GO) Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IMP	3678831
GO:0000785	Component	Chromatin	IDA	12121620, 15014043
GO:0000794	Component	Condensed nuclear chromosome	IDA	15014043
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IDA	2677018
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IDA	1944575
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IMP	11336674
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	TAS
GO:0005515	Function	Protein binding	IPI	1961752, 7616957, 9637251, 11336674, 11932251, 16820410, 18617507, 20668449, 20739938, 29040603, 29997244, 31467278, 33961781, 34564892, 35271311, 37398436
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	17435751
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005694	Component	Chromosome	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17435751
GO:0005737	Component	Cytoplasm	IEA
GO:0007052	Process	Mitotic spindle organization	IDA	15014043
GO:0007059	Process	Chromosome segregation	IMP	17435751
GO:0007084	Process	Mitotic nuclear membrane reassembly	TAS
GO:0007088	Process	Regulation of mitotic nuclear division	IDA	15014043
GO:0007346	Process	Regulation of mitotic cell cycle	IBA
GO:0016032	Process	Viral process	TAS
GO:0031267	Function	Small GTPase binding	IDA	11336674
GO:0031491	Function	Nucleosome binding	IMP	20347844
GO:0031492	Function	Nucleosomal DNA binding	IDA	17435751
GO:0032991	Component	Protein-containing complex	IDA	11336674
GO:0042393	Function	Histone binding	IDA	11375490
GO:0043199	Function	Sulfate binding	IDA	11336674
GO:0046982	Function	Protein heterodimerization activity	IPI	11336674
GO:0051225	Process	Spindle assembly	IMP	17435751
GO:0051301	Process	Cell division	IEA
GO:1901673	Process	Regulation of mitotic spindle assembly	IBA

Other IDs

• MIM: 179710
• HGNC: 1913
• e!Ensembl: ENSG00000180198

Protein

• UniProt ID: P18754
• Protein name: Regulator of chromosome condensation (Cell cycle regulatory protein) (Chromosome condensation protein 1)
• Protein function: Guanine-nucleotide releasing factor that promotes the exchange of Ran-bound GDP by GTP, and thereby plays an important role in RAN-mediated functions in nuclear import and mitosis (PubMed:11336674, PubMed:17435751, PubMed:1944575, PubMed:2066844
• PDB: 1A12 , 1I2M , 5E1B , 5E1D , 5E1M , 5E1O , 5E2A , 5E2B , 5TBK , 6DUB , 8UX1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00415	RCC1	85 → 134	Regulator of chromosome condensation (RCC1) repeat	Repeat
  PF00415	RCC1	190 → 255	Regulator of chromosome condensation (RCC1) repeat	Repeat
  PF00415	RCC1	363 → 414	Regulator of chromosome condensation (RCC1) repeat	Repeat
  PF00415	RCC1	258 → 309	Regulator of chromosome condensation (RCC1) repeat	Repeat
  PF00415	RCC1	34 → 82	Regulator of chromosome condensation (RCC1) repeat	Repeat
  PF00415	RCC1	312 → 360	Regulator of chromosome condensation (RCC1) repeat	Repeat
  PF00415	RCC1	137 → 187	Regulator of chromosome condensation (RCC1) repeat	Repeat

• Sequence:

  MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKP
  ALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEK
  VVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASG
  NDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHV
  RFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFS
  GGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAV
  TKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQ
  S

• Sequence length: 421

Pathways

Reactome Pathway

Rev-mediated nuclear export of HIV RNA

Nuclear import of Rev protein

Postmitotic nuclear pore complex (NPC) reformation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
INFECTION-INDUCED ACUTE-ONSET AXONAL NEUROPATHY	Likely pathogenic; Pathogenic	rs777909472	RCV005638358	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Associations from Text Mining Show/Hide Text Mining Associations (33)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Asthma	Asthma	BEFREE	11956218		★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	29363114		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	1699883, 19075597, 23460808, 29363114		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28163220, 40163507	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	33740472	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	29789527		★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	26659575	Inhibit	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29789527		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29789527		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26864624	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23460808		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	34924821	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	1699883, 19075597, 23460808, 29363114		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12115502		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	30323976		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30769871, 30806297		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29789527		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29363114		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10491433, 26823742		★☆☆☆☆ Found in Text Mining only
Nephronophthisis	Nephronophthisis	BEFREE	22899815		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	22899815		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12115502		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23460808		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	LHGDN	16052169		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	20631154		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa 2	Retinitis pigmentosa	Pubtator	16052169	Associate	★☆☆☆☆ Found in Text Mining only
RETINITIS PIGMENTOSA 3	Retinitis Pigmentosa	BEFREE	8673101, 8817343		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26823742		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26823742	Inhibit	★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	26659575	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	30323976		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34356619	Associate	★☆☆☆☆ Found in Text Mining only
X-linked retinitis pigmentosa	Retinitis Pigmentosa, X-Linked	BEFREE	20631154, 8673101, 8817343		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

RAN 3 shared pathwaysRev-mediated nuclear export of HIV RNA, Nuclear import of Rev protein, Postmitotic nuclear pore complex (NPC) reformation Related via 3 shared pathways including Rev-mediated nuclear export of HIV RNA, Nuclear import of Rev protein. RANGAP1 2 shared pathwaysRev-mediated nuclear export of HIV RNA, Postmitotic nuclear pore complex (NPC) reformation Related via 2 shared pathways including Rev-mediated nuclear export of HIV RNA, Postmitotic nuclear pore complex (NPC) reformation. NUP35 2 shared pathwaysRev-mediated nuclear export of HIV RNA, Postmitotic nuclear pore complex (NPC) reformation Related via 2 shared pathways including Rev-mediated nuclear export of HIV RNA, Postmitotic nuclear pore complex (NPC) reformation. NUP205 2 shared pathwaysRev-mediated nuclear export of HIV RNA, Postmitotic nuclear pore complex (NPC) reformation Related via 2 shared pathways including Rev-mediated nuclear export of HIV RNA, Postmitotic nuclear pore complex (NPC) reformation. NUP188 2 shared pathwaysRev-mediated nuclear export of HIV RNA, Postmitotic nuclear pore complex (NPC) reformation Related via 2 shared pathways including Rev-mediated nuclear export of HIV RNA, Postmitotic nuclear pore complex (NPC) reformation.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
RAN	0	[]	3	["Rev-mediated nuclear export of HIV RNA","Nuclear import of Rev protein","Postmitotic nuclear pore complex (NPC) reformation"]	0	[]
RANGAP1	0	[]	2	["Rev-mediated nuclear export of HIV RNA","Postmitotic nuclear pore complex (NPC) reformation"]	0	[]
NUP35	0	[]	2	["Rev-mediated nuclear export of HIV RNA","Postmitotic nuclear pore complex (NPC) reformation"]	0	[]
NUP205	0	[]	2	["Rev-mediated nuclear export of HIV RNA","Postmitotic nuclear pore complex (NPC) reformation"]	0	[]
NUP188	0	[]	2	["Rev-mediated nuclear export of HIV RNA","Postmitotic nuclear pore complex (NPC) reformation"]	0	[]

Diseases Linked via Similar Genes

Schizophrenia Linked via 2 of 5 related genesRANGAP1, NUP205 Carcinoma Linked via 1 of 5 related genesRAN Diabetes mellitus type 1 Linked via 1 of 5 related genesRAN Osteoarthritis Linked via 1 of 5 related genesRAN Panic disorder Linked via 1 of 5 related genesRAN

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Schizophrenia	2	["RANGAP1","NUP205"]
Carcinoma	1	["RAN"]
Diabetes mellitus type 1	1	["RAN"]
Osteoarthritis	1	["RAN"]
Panic disorder	1	["RAN"]