Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	255426
Gene name	RasGEF domain family member 1C
Gene symbol	RASGEF1C
Synonyms (NCBI Gene)	-
Chromosome	5
Chromosome location	5q35.3

61 Show/Hide all (61)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018443	hsa-miR-335-5p	Microarray	18185580
MIRT1292267	hsa-miR-1972	CLIP-seq
MIRT1292268	hsa-miR-214	CLIP-seq
MIRT1292269	hsa-miR-2467-3p	CLIP-seq
MIRT1292270	hsa-miR-3158-5p	CLIP-seq
MIRT1292271	hsa-miR-3180	CLIP-seq
MIRT1292272	hsa-miR-3180-3p	CLIP-seq
MIRT1292273	hsa-miR-3196	CLIP-seq
MIRT1292274	hsa-miR-3619-5p	CLIP-seq
MIRT1292275	hsa-miR-3678-3p	CLIP-seq
MIRT1292276	hsa-miR-4283	CLIP-seq
MIRT1292277	hsa-miR-4488	CLIP-seq
MIRT1292278	hsa-miR-4489	CLIP-seq
MIRT1292279	hsa-miR-4690-5p	CLIP-seq
MIRT1292280	hsa-miR-4697-5p	CLIP-seq
MIRT1292281	hsa-miR-619	CLIP-seq
MIRT1292282	hsa-miR-761	CLIP-seq
MIRT1292268	hsa-miR-214	CLIP-seq
MIRT2086855	hsa-miR-3151	CLIP-seq
MIRT1292271	hsa-miR-3180	CLIP-seq
MIRT1292272	hsa-miR-3180-3p	CLIP-seq
MIRT1292273	hsa-miR-3196	CLIP-seq
MIRT1292274	hsa-miR-3619-5p	CLIP-seq
MIRT2086856	hsa-miR-4318	CLIP-seq
MIRT2086857	hsa-miR-4447	CLIP-seq
MIRT2086858	hsa-miR-4472	CLIP-seq
MIRT1292277	hsa-miR-4488	CLIP-seq
MIRT1292280	hsa-miR-4697-5p	CLIP-seq
MIRT2086859	hsa-miR-491-5p	CLIP-seq
MIRT1292282	hsa-miR-761	CLIP-seq
MIRT2086855	hsa-miR-3151	CLIP-seq
MIRT1292271	hsa-miR-3180	CLIP-seq
MIRT1292272	hsa-miR-3180-3p	CLIP-seq
MIRT1292273	hsa-miR-3196	CLIP-seq
MIRT2311791	hsa-miR-4252	CLIP-seq
MIRT2086856	hsa-miR-4318	CLIP-seq
MIRT2086857	hsa-miR-4447	CLIP-seq
MIRT2086858	hsa-miR-4472	CLIP-seq
MIRT1292277	hsa-miR-4488	CLIP-seq
MIRT2311792	hsa-miR-4492	CLIP-seq
MIRT2311793	hsa-miR-4498	CLIP-seq
MIRT1292280	hsa-miR-4697-5p	CLIP-seq
MIRT2086859	hsa-miR-491-5p	CLIP-seq
MIRT2311794	hsa-miR-762	CLIP-seq
MIRT2086855	hsa-miR-3151	CLIP-seq
MIRT1292271	hsa-miR-3180	CLIP-seq
MIRT1292272	hsa-miR-3180-3p	CLIP-seq
MIRT1292273	hsa-miR-3196	CLIP-seq
MIRT2311791	hsa-miR-4252	CLIP-seq
MIRT2086856	hsa-miR-4318	CLIP-seq
MIRT2086857	hsa-miR-4447	CLIP-seq
MIRT2086858	hsa-miR-4472	CLIP-seq
MIRT1292277	hsa-miR-4488	CLIP-seq
MIRT1292280	hsa-miR-4697-5p	CLIP-seq
MIRT2086859	hsa-miR-491-5p	CLIP-seq
MIRT2608209	hsa-miR-370	CLIP-seq
MIRT2608210	hsa-miR-4474-3p	CLIP-seq
MIRT2608211	hsa-miR-4763-5p	CLIP-seq
MIRT2608209	hsa-miR-370	CLIP-seq
MIRT2608210	hsa-miR-4474-3p	CLIP-seq
MIRT2608211	hsa-miR-4763-5p	CLIP-seq

GO ID	Ontology	Definition	Evidence
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0007265	Process	Ras protein signal transduction	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q8N431

Protein name

Ras-GEF domain-containing family member 1C

Protein function

Guanine nucleotide exchange factor (GEF).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00617	RasGEF	203 → 396	RasGEF domain	Family
PF00618	RasGEF_N	37 → 138	RasGEF N-terminal motif	Domain

Sequence

MPQTLSASDMVTPGSLSPPPTEPTDGEQAGQPLLDGAPSSASLETLIQHLVPTADYYPEK
AYIFTFLLSSRLFIEPRELLARVCHLCIEQQQLDKPVLDKARVRKFGPKLLQLLAEWTET
FPRDFQEESTIGHLKDVVGRIAPCDEAYRKRMHQLLQALHQKLAALRQGPEGLVGADKPI
SYRTKPPASIHRELLGVCSDPYTLAQQLTHVELERLRHIGPEEFVQAFVNKDPLASTKPC
FSDKTSNLEAYVKWFNRLCYLVATEICMPAKKKQRAQVIEFFIDVARECFNIGNFNSLMA
IISGMNMSPVSRLKKTWAKVRTAKFFILEHQMDPTGNFCNYRTALRGAAHRSLTAHSSRE
KIVIPFFSLLIKDIYFLNEGCANRLPNGHVNFEKFLELAKQVGEFITWKQVECPFEQDAS
ITHYLYTAPIFSEDGLYLASYESESPENQTEKERWKALRSSILGKT

Sequence length

466

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (7)
ALZHEIMER DISEASE	—	GWAS catalog	35379992, 35851147, 37198259, 37985413	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	37069358	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	39046104	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	32121467	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	35851147	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	30804565, 35835914	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	32121467	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	34584172	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	34572079	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RASGEF1C (RasGEF domain family member 1C)

Bookmark This Gene