RAB5IF (RAB5 interacting factor)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 55969
Gene name RAB5 interacting factor
Gene symbol RAB5IF
Synonyms (NCBI Gene)
C20orf24CFSMR2OPTIPNAS-11RCAF1RIP5
Chromosome 20
Chromosome location 20q11.23
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 31536960
GO:0005739 Component Mitochondrion IEA
GO:0005739 Component Mitochondrion IMP 31536960
GO:0005743 Component Mitochondrial inner membrane IEA
GO:0005783 Component Endoplasmic reticulum IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
619960 15870 ENSG00000101084
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BUV8
Protein name GEL complex subunit OPTI (Obligate partner of TMCO1 insertase) (Rab5-interacting protein) (RIP5) (Respirasome Complex Assembly Factor 1)
Protein function Component of the multi-pass translocon (MPT) complex that mediates insertion of multi-pass membrane proteins into the lipid bilayer of membranes (PubMed:36261522). The MPT complex takes over after the SEC61 complex: following membrane insertion
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07019 Rab5ip 44 → 120 Rab5-interacting protein (Rab5ip) Family
Tissue specificity TISSUE SPECIFICITY: Expressed in embryonic stem cells and differentiated neuronal cells. {ECO:0000269|PubMed:31536960}.
Sequence 
MSGGRRKEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEFLDVIYWFRQIIAVVLGVIW
GVLPLRGFLGIAGFCLINAGVLYLYFSNYLQIDEEEYGGTWELTKEGFMTSFALFMVCVA
DSFTTGHLDHLLHCHPL
Sequence length 137
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
20
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Craniofacial dysmorphism, skeletal anomalies, and impaired intellectual development 1 Likely pathogenic; Pathogenic rs1464308137 RCV002241663
★★★★★
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Craniofacial dysmorphism, skeletal anomalies, and impaired intellectual development syndrome 2 Likely pathogenic; Pathogenic rs1464308137 RCV002267636
★★★★★
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Show/Hide Unknown Diseases (18)
Phenotype Name Clinical Significance Source Reference Evidence Score
BREAST CARCINOMA — GWAS catalog 32887889
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CANCER — GWAS catalog 32887889
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CLEFT PALATE AND BILATERAL CLEFT LIP — Disgenet —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER — GWAS catalog 32887889
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CONGENITAL FUSION OF RIBS — Disgenet —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
B-Cell Lymphomas B-Cell Lymphoma BEFREE 31717443
★★★★★
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma BEFREE 31717443
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
TGIF2-RAB5IF 7 shared diseasesCancer, Cleft palate and bilateral cleft lip, Congenital fusion of ribs, Craniofacial dysmorphism skeletal anomalies intellectual disability syndrome, Estrogen-receptor negative breast cancer, Micrognathism, Ovarian serous carcinoma 9 shared evidence sourcesGWAS catalog (Cancer), Disgenet (Cleft palate and bilateral cleft lip), Disgenet (Congenital fusion of ribs), Disgenet (Craniofacial dysmorphism skeletal anomalies intellectual disability syndrome), GWAS catalog (Melanoma), GWAS catalog (Estrogen-receptor negative breast cancer), Disgenet (Micrognathism), GWAS catalog (Ovarian serous carcinoma), Disgenet (Scoliosis) Related via 7 shared diseases including Cancer, Cleft palate and bilateral cleft lip — evidence mostly Disgenet. LMTK2 3 shared diseasesCancer, Estrogen-receptor negative breast cancer, Ovarian serous carcinoma 3 shared evidence sourcesGWAS catalog (Cancer), GWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Ovarian serous carcinoma) Related via 3 shared diseases including Cancer, Estrogen-receptor negative breast cancer — evidence mostly GWAS catalog. PRKCI 3 shared diseasesCancer, Estrogen-receptor negative breast cancer, Ovarian serous carcinoma 3 shared evidence sourcesGWAS catalog (Cancer), GWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Ovarian serous carcinoma) Related via 3 shared diseases including Cancer, Estrogen-receptor negative breast cancer — evidence mostly GWAS catalog. SLC22A31 3 shared diseasesCancer, Estrogen-receptor negative breast cancer, Ovarian serous carcinoma 4 shared evidence sourcesGWAS catalog (Cancer), GWAS catalog (Melanoma), GWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Ovarian serous carcinoma) Related via 3 shared diseases including Cancer, Estrogen-receptor negative breast cancer — evidence mostly GWAS catalog. SMIM38 3 shared diseasesCancer, Estrogen-receptor negative breast cancer, Ovarian serous carcinoma 4 shared evidence sourcesGWAS catalog (Cancer), GWAS catalog (Melanoma), GWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Ovarian serous carcinoma) Related via 3 shared diseases including Cancer, Estrogen-receptor negative breast cancer — evidence mostly GWAS catalog.
Non-melanoma skin carcinoma Linked via 2 of 5 related genesTGIF2-RAB5IF, SLC22A31 Diabetes mellitus type 2 Linked via 2 of 5 related genesLMTK2, SMIM38 Gout Linked via 1 of 5 related genesLMTK2 Neurotic disorder Linked via 1 of 5 related genesLMTK2 Prostatic neoplasms Linked via 1 of 5 related genesLMTK2