SMIM38 (small integral membrane protein 38)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 107984345
Gene name Small integral membrane protein 38
Gene symbol SMIM38
Synonyms (NCBI Gene)
-
Chromosome 11
Chromosome location 11q13.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A286YFK9
Protein name Small integral membrane protein 38
Family and domains
Sequence 
MTSWPGGSFGPDPLLALLVVILLARLILWSCLGTYIDYRLAQRRPQKPKQD
Sequence length 51
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
18
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Show/Hide Unknown Diseases (18)
Phenotype Name Clinical Significance Source Reference Evidence Score
ATRIAL FIBRILLATION — GWAS catalog 40050429
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CANCER — GWAS catalog 29059683
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA — GWAS catalog 27197191, 27432226, 29059683, 32887889
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CANCER — GWAS catalog 27197191, 32887889, 35729236
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Sort by:
LMTK2 3 shared diseasesCancer, Estrogen-receptor negative breast cancer, Ovarian serous carcinoma 3 shared evidence sourcesGWAS catalog (Cancer), GWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Ovarian serous carcinoma) Related via 3 shared diseases including Cancer, Estrogen-receptor negative breast cancer — evidence mostly GWAS catalog. PRKCI 3 shared diseasesCancer, Estrogen-receptor negative breast cancer, Ovarian serous carcinoma 3 shared evidence sourcesGWAS catalog (Cancer), GWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Ovarian serous carcinoma) Related via 3 shared diseases including Cancer, Estrogen-receptor negative breast cancer — evidence mostly GWAS catalog. SLC22A31 3 shared diseasesCancer, Estrogen-receptor negative breast cancer, Ovarian serous carcinoma 4 shared evidence sourcesGWAS catalog (Cancer), GWAS catalog (Melanoma), GWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Ovarian serous carcinoma) Related via 3 shared diseases including Cancer, Estrogen-receptor negative breast cancer — evidence mostly GWAS catalog. MSMB 3 shared diseasesCancer, Estrogen-receptor negative breast cancer, Ovarian serous carcinoma 3 shared evidence sourcesGWAS catalog (Cancer), GWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Ovarian serous carcinoma) Related via 3 shared diseases including Cancer, Estrogen-receptor negative breast cancer — evidence mostly GWAS catalog. KLK2 3 shared diseasesCancer, Estrogen-receptor negative breast cancer, Ovarian serous carcinoma 3 shared evidence sourcesGWAS catalog (Cancer), GWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Ovarian serous carcinoma) Related via 3 shared diseases including Cancer, Estrogen-receptor negative breast cancer — evidence mostly GWAS catalog.
Prostatic neoplasms Linked via 3 of 5 related genesLMTK2, MSMB, KLK2 Gout Linked via 1 of 5 related genesLMTK2 Neurotic disorder Linked via 1 of 5 related genesLMTK2 Autism Linked via 1 of 5 related genesPRKCI Bipolar disorder Linked via 1 of 5 related genesPRKCI