RAB4A (RAB4A, member RAS oncogene family)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5867
• Gene name: RAB4A, member RAS oncogene family
• Gene symbol: RAB4A
• Synonyms (NCBI Gene): HRES-1, HRES-1/RAB4, HRES1, RAB4
• Chromosome: 1
• Chromosome location: 1q42.13
• Summary: This gene is a member of the largest group in the Ras superfamily of small GTPases, which regulate membrane trafficking. The encoded protein is associated with early endosomes and is involved in their sorting and recycling. The protein also plays a role i

miRNA Show/Hide all (291)

miRTarBase ID	miRNA	Experiments	Reference
MIRT700351	hsa-miR-3929	HITS-CLIP	23313552
MIRT700350	hsa-miR-4419b	HITS-CLIP	23313552
MIRT700349	hsa-miR-4478	HITS-CLIP	23313552
MIRT700348	hsa-miR-188-5p	HITS-CLIP	23313552
MIRT700347	hsa-miR-6866-3p	HITS-CLIP	23313552
MIRT700346	hsa-miR-383-3p	HITS-CLIP	23313552
MIRT700345	hsa-miR-4780	HITS-CLIP	23313552
MIRT700344	hsa-miR-6780b-3p	HITS-CLIP	23313552
MIRT700343	hsa-miR-7162-3p	HITS-CLIP	23313552
MIRT700342	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT700341	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT700340	hsa-miR-7854-3p	HITS-CLIP	23313552
MIRT700339	hsa-miR-6134	HITS-CLIP	23313552
MIRT700338	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT700337	hsa-miR-4747-5p	HITS-CLIP	23313552
MIRT700336	hsa-miR-5196-5p	HITS-CLIP	23313552
MIRT700335	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT700334	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT700333	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT700332	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT700331	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT700330	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT700328	hsa-miR-7977	HITS-CLIP	23313552
MIRT700329	hsa-miR-623	HITS-CLIP	23313552
MIRT700327	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT700326	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT700325	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT700324	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT700323	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT700322	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT700321	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT700320	hsa-miR-3689c	HITS-CLIP	23313552
MIRT700319	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT700318	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT700317	hsa-miR-450a-1-3p	HITS-CLIP	23313552
MIRT700316	hsa-miR-3122	HITS-CLIP	23313552
MIRT700315	hsa-miR-3913-5p	HITS-CLIP	23313552
MIRT700314	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT700313	hsa-miR-6513-5p	HITS-CLIP	23313552
MIRT700312	hsa-miR-665	HITS-CLIP	23313552
MIRT636300	hsa-miR-634	HITS-CLIP	23824327
MIRT636299	hsa-miR-4687-5p	HITS-CLIP	23824327
MIRT636298	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT636297	hsa-miR-4290	HITS-CLIP	23824327
MIRT636296	hsa-miR-5580-5p	HITS-CLIP	23824327
MIRT546846	hsa-miR-488-3p	PAR-CLIP	21572407
MIRT546845	hsa-miR-1537-3p	PAR-CLIP	21572407
MIRT546844	hsa-miR-3609	PAR-CLIP	21572407
MIRT546843	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT546842	hsa-miR-651-3p	PAR-CLIP	21572407
MIRT546841	hsa-miR-4517	PAR-CLIP	21572407
MIRT546840	hsa-miR-494-3p	PAR-CLIP	21572407
MIRT546839	hsa-miR-5681a	PAR-CLIP	21572407
MIRT546838	hsa-miR-6730-5p	PAR-CLIP	21572407
MIRT546837	hsa-miR-3148	PAR-CLIP	21572407
MIRT546846	hsa-miR-488-3p	PAR-CLIP	21572407
MIRT546845	hsa-miR-1537-3p	PAR-CLIP	21572407
MIRT546844	hsa-miR-3609	PAR-CLIP	21572407
MIRT546843	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT546842	hsa-miR-651-3p	PAR-CLIP	21572407
MIRT546841	hsa-miR-4517	PAR-CLIP	21572407
MIRT546840	hsa-miR-494-3p	PAR-CLIP	21572407
MIRT546839	hsa-miR-5681a	PAR-CLIP	21572407
MIRT546838	hsa-miR-6730-5p	PAR-CLIP	21572407
MIRT546837	hsa-miR-3148	PAR-CLIP	21572407
MIRT521492	hsa-miR-125a-5p	PAR-CLIP	23446348
MIRT521491	hsa-miR-125b-5p	PAR-CLIP	23446348
MIRT521490	hsa-miR-4319	PAR-CLIP	23446348
MIRT521489	hsa-miR-1292-3p	PAR-CLIP	23446348
MIRT521488	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT521487	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT521486	hsa-miR-7976	PAR-CLIP	23446348
MIRT521485	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT521484	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT521483	hsa-miR-1291	PAR-CLIP	23446348
MIRT521482	hsa-miR-6775-3p	PAR-CLIP	23446348
MIRT521481	hsa-miR-877-5p	PAR-CLIP	23446348
MIRT521480	hsa-miR-6866-5p	PAR-CLIP	23446348
MIRT521479	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT521478	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT700351	hsa-miR-3929	HITS-CLIP	23313552
MIRT700350	hsa-miR-4419b	HITS-CLIP	23313552
MIRT700349	hsa-miR-4478	HITS-CLIP	23313552
MIRT700348	hsa-miR-188-5p	HITS-CLIP	23313552
MIRT700347	hsa-miR-6866-3p	HITS-CLIP	23313552
MIRT700346	hsa-miR-383-3p	HITS-CLIP	23313552
MIRT700345	hsa-miR-4780	HITS-CLIP	23313552
MIRT700344	hsa-miR-6780b-3p	HITS-CLIP	23313552
MIRT700343	hsa-miR-7162-3p	HITS-CLIP	23313552
MIRT700342	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT700341	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT700340	hsa-miR-7854-3p	HITS-CLIP	23313552
MIRT700339	hsa-miR-6134	HITS-CLIP	23313552
MIRT700338	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT700337	hsa-miR-4747-5p	HITS-CLIP	23313552
MIRT700336	hsa-miR-5196-5p	HITS-CLIP	23313552
MIRT700335	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT700334	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT700333	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT700332	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT700331	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT700330	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT700328	hsa-miR-7977	HITS-CLIP	23313552
MIRT700329	hsa-miR-623	HITS-CLIP	23313552
MIRT700327	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT700326	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT700325	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT700324	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT700323	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT700322	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT700321	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT700320	hsa-miR-3689c	HITS-CLIP	23313552
MIRT700319	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT700318	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT700317	hsa-miR-450a-1-3p	HITS-CLIP	23313552
MIRT700316	hsa-miR-3122	HITS-CLIP	23313552
MIRT700315	hsa-miR-3913-5p	HITS-CLIP	23313552
MIRT700314	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT700313	hsa-miR-6513-5p	HITS-CLIP	23313552
MIRT700312	hsa-miR-665	HITS-CLIP	23313552
MIRT636300	hsa-miR-634	HITS-CLIP	23824327
MIRT636299	hsa-miR-4687-5p	HITS-CLIP	23824327
MIRT636298	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT636297	hsa-miR-4290	HITS-CLIP	23824327
MIRT636296	hsa-miR-5580-5p	HITS-CLIP	23824327
MIRT546846	hsa-miR-488-3p	PAR-CLIP	21572407
MIRT546845	hsa-miR-1537-3p	PAR-CLIP	21572407
MIRT546844	hsa-miR-3609	PAR-CLIP	21572407
MIRT546843	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT546842	hsa-miR-651-3p	PAR-CLIP	21572407
MIRT546841	hsa-miR-4517	PAR-CLIP	21572407
MIRT546840	hsa-miR-494-3p	PAR-CLIP	21572407
MIRT546839	hsa-miR-5681a	PAR-CLIP	21572407
MIRT546838	hsa-miR-6730-5p	PAR-CLIP	21572407
MIRT546837	hsa-miR-3148	PAR-CLIP	21572407
MIRT546846	hsa-miR-488-3p	PAR-CLIP	21572407
MIRT546845	hsa-miR-1537-3p	PAR-CLIP	21572407
MIRT546844	hsa-miR-3609	PAR-CLIP	21572407
MIRT546843	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT546842	hsa-miR-651-3p	PAR-CLIP	21572407
MIRT546841	hsa-miR-4517	PAR-CLIP	21572407
MIRT546840	hsa-miR-494-3p	PAR-CLIP	21572407
MIRT546839	hsa-miR-5681a	PAR-CLIP	21572407
MIRT546838	hsa-miR-6730-5p	PAR-CLIP	21572407
MIRT546837	hsa-miR-3148	PAR-CLIP	21572407
MIRT521492	hsa-miR-125a-5p	PAR-CLIP	23446348
MIRT521491	hsa-miR-125b-5p	PAR-CLIP	23446348
MIRT521490	hsa-miR-4319	PAR-CLIP	23446348
MIRT521489	hsa-miR-1292-3p	PAR-CLIP	23446348
MIRT521488	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT521487	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT521486	hsa-miR-7976	PAR-CLIP	23446348
MIRT521485	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT521484	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT521483	hsa-miR-1291	PAR-CLIP	23446348
MIRT521482	hsa-miR-6775-3p	PAR-CLIP	23446348
MIRT521481	hsa-miR-877-5p	PAR-CLIP	23446348
MIRT521480	hsa-miR-6866-5p	PAR-CLIP	23446348
MIRT521479	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT521478	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT1284954	hsa-miR-101	CLIP-seq
MIRT1284955	hsa-miR-1227	CLIP-seq
MIRT1284956	hsa-miR-1243	CLIP-seq
MIRT1284957	hsa-miR-1272	CLIP-seq
MIRT1284958	hsa-miR-1290	CLIP-seq
MIRT1284959	hsa-miR-217	CLIP-seq
MIRT1284960	hsa-miR-298	CLIP-seq
MIRT1284961	hsa-miR-3064-3p	CLIP-seq
MIRT1284962	hsa-miR-3136-5p	CLIP-seq
MIRT1284963	hsa-miR-3167	CLIP-seq
MIRT1284964	hsa-miR-3180-5p	CLIP-seq
MIRT1284965	hsa-miR-3591-3p	CLIP-seq
MIRT1284966	hsa-miR-3591-5p	CLIP-seq
MIRT1284967	hsa-miR-3668	CLIP-seq
MIRT1284968	hsa-miR-3678-3p	CLIP-seq
MIRT1284969	hsa-miR-371-3p	CLIP-seq
MIRT1284970	hsa-miR-371b-3p	CLIP-seq
MIRT1284971	hsa-miR-410	CLIP-seq
MIRT1284972	hsa-miR-4252	CLIP-seq
MIRT1284973	hsa-miR-4327	CLIP-seq
MIRT1284974	hsa-miR-4439	CLIP-seq
MIRT1284975	hsa-miR-4473	CLIP-seq
MIRT1284976	hsa-miR-4643	CLIP-seq
MIRT1284977	hsa-miR-466	CLIP-seq
MIRT1284978	hsa-miR-4671-3p	CLIP-seq
MIRT1284979	hsa-miR-4738-3p	CLIP-seq
MIRT1284980	hsa-miR-4753-3p	CLIP-seq
MIRT1284981	hsa-miR-4789-3p	CLIP-seq
MIRT1284982	hsa-miR-485-3p	CLIP-seq
MIRT1284983	hsa-miR-487a	CLIP-seq
MIRT1284984	hsa-miR-499-3p	CLIP-seq
MIRT1284985	hsa-miR-499a-3p	CLIP-seq
MIRT1284986	hsa-miR-515-3p	CLIP-seq
MIRT1284987	hsa-miR-519e	CLIP-seq
MIRT1284988	hsa-miR-520a-5p	CLIP-seq
MIRT1284989	hsa-miR-525-5p	CLIP-seq
MIRT1284990	hsa-miR-539	CLIP-seq
MIRT1284991	hsa-miR-553	CLIP-seq
MIRT1284992	hsa-miR-582-3p	CLIP-seq
MIRT1284993	hsa-miR-876-5p	CLIP-seq
MIRT1284994	hsa-miR-889	CLIP-seq
MIRT1284995	hsa-miR-892b	CLIP-seq
MIRT1284996	hsa-miR-943	CLIP-seq
MIRT2084586	hsa-miR-105	CLIP-seq
MIRT2084587	hsa-miR-325	CLIP-seq
MIRT2084588	hsa-miR-3942-3p	CLIP-seq
MIRT1284972	hsa-miR-4252	CLIP-seq
MIRT2084589	hsa-miR-4668-3p	CLIP-seq
MIRT2084590	hsa-miR-628-3p	CLIP-seq
MIRT1284954	hsa-miR-101	CLIP-seq
MIRT2084586	hsa-miR-105	CLIP-seq
MIRT2309797	hsa-miR-144	CLIP-seq
MIRT2309798	hsa-miR-2278	CLIP-seq
MIRT2309799	hsa-miR-3145-5p	CLIP-seq
MIRT2309800	hsa-miR-3545-3p	CLIP-seq
MIRT2309801	hsa-miR-3657	CLIP-seq
MIRT2309802	hsa-miR-378g	CLIP-seq
MIRT2084588	hsa-miR-3942-3p	CLIP-seq
MIRT1284971	hsa-miR-410	CLIP-seq
MIRT1284972	hsa-miR-4252	CLIP-seq
MIRT2309803	hsa-miR-4436a	CLIP-seq
MIRT2309804	hsa-miR-4539	CLIP-seq
MIRT2309805	hsa-miR-4669	CLIP-seq
MIRT2309806	hsa-miR-4700-3p	CLIP-seq
MIRT1284982	hsa-miR-485-3p	CLIP-seq
MIRT1284983	hsa-miR-487a	CLIP-seq
MIRT1284984	hsa-miR-499-3p	CLIP-seq
MIRT1284985	hsa-miR-499a-3p	CLIP-seq
MIRT2309807	hsa-miR-508-5p	CLIP-seq
MIRT2309808	hsa-miR-548v	CLIP-seq
MIRT2309809	hsa-miR-592	CLIP-seq
MIRT2309810	hsa-miR-599	CLIP-seq
MIRT1284995	hsa-miR-892b	CLIP-seq
MIRT2432415	hsa-miR-421	CLIP-seq
MIRT2432416	hsa-miR-4487	CLIP-seq
MIRT2432417	hsa-miR-4520a-3p	CLIP-seq
MIRT2432418	hsa-miR-4638-3p	CLIP-seq
MIRT2084589	hsa-miR-4668-3p	CLIP-seq
MIRT2432419	hsa-miR-4709-5p	CLIP-seq
MIRT1284954	hsa-miR-101	CLIP-seq
MIRT1284955	hsa-miR-1227	CLIP-seq
MIRT2309797	hsa-miR-144	CLIP-seq
MIRT2606384	hsa-miR-1537	CLIP-seq
MIRT1284959	hsa-miR-217	CLIP-seq
MIRT1284961	hsa-miR-3064-3p	CLIP-seq
MIRT1284966	hsa-miR-3591-5p	CLIP-seq
MIRT1284969	hsa-miR-371-3p	CLIP-seq
MIRT1284970	hsa-miR-371b-3p	CLIP-seq
MIRT2309802	hsa-miR-378g	CLIP-seq
MIRT2606385	hsa-miR-4307	CLIP-seq
MIRT2309803	hsa-miR-4436a	CLIP-seq
MIRT1284975	hsa-miR-4473	CLIP-seq
MIRT1284978	hsa-miR-4671-3p	CLIP-seq
MIRT2309806	hsa-miR-4700-3p	CLIP-seq
MIRT1284979	hsa-miR-4738-3p	CLIP-seq
MIRT1284982	hsa-miR-485-3p	CLIP-seq
MIRT1284983	hsa-miR-487a	CLIP-seq
MIRT2606386	hsa-miR-488	CLIP-seq
MIRT1284984	hsa-miR-499-3p	CLIP-seq
MIRT1284985	hsa-miR-499a-3p	CLIP-seq
MIRT1284986	hsa-miR-515-3p	CLIP-seq
MIRT1284987	hsa-miR-519e	CLIP-seq
MIRT2606387	hsa-miR-548ah	CLIP-seq
MIRT2309808	hsa-miR-548v	CLIP-seq
MIRT1284954	hsa-miR-101	CLIP-seq
MIRT1284955	hsa-miR-1227	CLIP-seq
MIRT1284957	hsa-miR-1272	CLIP-seq
MIRT2309797	hsa-miR-144	CLIP-seq
MIRT2606384	hsa-miR-1537	CLIP-seq
MIRT2689254	hsa-miR-19a	CLIP-seq
MIRT2689255	hsa-miR-19b	CLIP-seq
MIRT1284959	hsa-miR-217	CLIP-seq
MIRT1284961	hsa-miR-3064-3p	CLIP-seq
MIRT1284966	hsa-miR-3591-5p	CLIP-seq
MIRT1284969	hsa-miR-371-3p	CLIP-seq
MIRT1284970	hsa-miR-371b-3p	CLIP-seq
MIRT2309802	hsa-miR-378g	CLIP-seq
MIRT1284971	hsa-miR-410	CLIP-seq
MIRT2606385	hsa-miR-4307	CLIP-seq
MIRT2309803	hsa-miR-4436a	CLIP-seq
MIRT1284975	hsa-miR-4473	CLIP-seq
MIRT1284978	hsa-miR-4671-3p	CLIP-seq
MIRT2309806	hsa-miR-4700-3p	CLIP-seq
MIRT1284979	hsa-miR-4738-3p	CLIP-seq
MIRT1284982	hsa-miR-485-3p	CLIP-seq
MIRT1284983	hsa-miR-487a	CLIP-seq
MIRT1284984	hsa-miR-499-3p	CLIP-seq
MIRT1284985	hsa-miR-499a-3p	CLIP-seq
MIRT1284986	hsa-miR-515-3p	CLIP-seq
MIRT1284987	hsa-miR-519e	CLIP-seq
MIRT2309808	hsa-miR-548v	CLIP-seq

Gene ontology (GO) Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	15907487, 16034420, 17562788
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS	2501306
GO:0003925	Function	G protein activity	IEA
GO:0005515	Function	Protein binding	IPI	16034420, 17562788, 19570034, 21988832, 25416956, 26496610, 28514442, 29997244, 31515488, 32296183, 33961781, 35271311
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IDA	15907487, 16034420
GO:0005525	Function	GTP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0015031	Process	Protein transport	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019003	Function	GDP binding	IDA	15907487, 16034420
GO:0019882	Process	Antigen processing and presentation	IMP	19717423
GO:0030100	Process	Regulation of endocytosis	IBA
GO:0030100	Process	Regulation of endocytosis	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	TAS
GO:0031901	Component	Early endosome membrane	IEA
GO:0031901	Component	Early endosome membrane	TAS
GO:0031982	Component	Vesicle	IDA	19590752
GO:0032482	Process	Rab protein signal transduction	IEA
GO:0032593	Component	Insulin-responsive compartment	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	19590752
GO:0055037	Component	Recycling endosome	IBA
GO:0055038	Component	Recycling endosome membrane	IEA
GO:0070062	Component	Extracellular exosome	IDA	15326289
GO:0098968	Process	Neurotransmitter receptor transport postsynaptic membrane to endosome	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099003	Process	Vesicle-mediated transport in synapse	IEA

Other IDs

• MIM: 179511
• HGNC: 9781
• e!Ensembl: ENSG00000168118

Protein

• UniProt ID: P20338
• Protein name: Ras-related protein Rab-4A (EC 3.6.5.2)
• Protein function: The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to r
• PDB: 1YU9 , 1Z0K , 2BMD , 2BME
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	15 → 176	Ras family	Domain

• Sequence:

  MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGK
  YVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIV
  IILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIES
  GELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC

• Sequence length: 218

Pathways

KEGG Pathway	Reactome Pathway
Endocytosis	Synthesis of PIPs at the plasma membrane
	TBC/RABGAPs
	RAB geranylgeranylation
	MET receptor recycling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Thymoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (52)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	2895757, 9345377		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	10880397	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21669283, 31460748	Stimulate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	12657672, 22262900, 28444573, 29602913		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	18240231		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	18240231	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10436175, 1280512, 7488288		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	25295378		★☆☆☆☆ Found in Text Mining only
Cerebral cortex myoclonus	Cerebral Cortex Myoclonus	BEFREE	31401489		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	17493033		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	21669283	Stimulate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	21669283	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital absence of lung	Congenital lung agenesis	BEFREE	18240231		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	8824727		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	9918381		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	12890772		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	28392472		★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	28444573		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	28053672		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	28391013		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	24725413		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	18240231		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	18240231	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	2895757		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	18240231	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	18432409, 19201859, 20014960, 20644481, 24117194, 31805010		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	1347429, 18240231, 19201859, 31805010	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	18432409, 19201859, 20014960, 20644481, 24117194, 31805010		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10436175, 15894513, 18240231, 18432409, 19201859, 20014960, 20644481, 24117194, 31805010, 7488288		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	18240231		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	18432409, 19201859, 20014960, 20644481, 24117194, 31805010		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15123618		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	19201859	Associate	★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	15009685		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	10433076, 11381188, 1347429	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	11381188, 25295378, 9345377		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29782920		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	21338355		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	14642273, 17979810, 22262900, 27258419, 28085018, 28392472, 29910724, 31073393		★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	21616478		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	22262900, 29910724		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	2501306	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	23720412	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15123618		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29767774	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	8824727		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	1347429	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	1347429	Associate	★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	25295378		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	31760199		★☆☆☆☆ Found in Text Mining only
T-Cell Large Granular Lymphocyte Leukemia	T-cell Lymphocytic Leukemia	BEFREE	25295378		★☆☆☆☆ Found in Text Mining only
Unverricht-Lundborg Syndrome	Myoclonic Epilepsy	BEFREE	25023721		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

RAB35 3 shared pathwaysEndocytosis, TBC/RABGAPs, RAB geranylgeranylation Related via 3 shared pathways including Endocytosis, TBC/RABGAPs. RAB22A 2 shared pathwaysEndocytosis, RAB geranylgeranylation Related via 2 shared pathways including Endocytosis, RAB geranylgeranylation. RUFY1 2 shared pathwaysEndocytosis, Synthesis of PIPs at the plasma membrane Related via 2 shared pathways including Endocytosis, Synthesis of PIPs at the plasma membrane. RABEP1 2 shared pathwaysEndocytosis, TBC/RABGAPs Related via 2 shared pathways including Endocytosis, TBC/RABGAPs. RAB33A 2 shared pathwaysTBC/RABGAPs, RAB geranylgeranylation Related via 2 shared pathways including TBC/RABGAPs, RAB geranylgeranylation.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
RAB35	0	[]	3	["Endocytosis","TBC\/RABGAPs","RAB geranylgeranylation"]	0	[]
RAB22A	0	[]	2	["Endocytosis","RAB geranylgeranylation"]	0	[]
RUFY1	0	[]	2	["Endocytosis","Synthesis of PIPs at the plasma membrane"]	0	[]
RABEP1	0	[]	2	["Endocytosis","TBC\/RABGAPs"]	0	[]
RAB33A	0	[]	2	["TBC\/RABGAPs","RAB geranylgeranylation"]	0	[]

Diseases Linked via Similar Genes

Neurodevelopmental disorder Linked via 1 of 5 related genesRAB35 Non-specific syndromic intellectual disability Linked via 1 of 5 related genesRAB35 Cervical cancer Linked via 1 of 5 related genesRAB22A Eating disorder Linked via 1 of 5 related genesRUFY1 Lung cancer Linked via 1 of 5 related genesRUFY1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Neurodevelopmental disorder	1	["RAB35"]
Non-specific syndromic intellectual disability	1	["RAB35"]
Cervical cancer	1	["RAB22A"]
Eating disorder	1	["RUFY1"]
Lung cancer	1	["RUFY1"]