RAB43 (RAB43, member RAS oncogene family)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 339122
• Gene name: RAB43, member RAS oncogene family
• Gene symbol: RAB43
• Synonyms (NCBI Gene): RAB11B, RAB41
• Chromosome: 3
• Chromosome location: 3q21.3

miRNA Show/Hide all (187)

miRTarBase ID	miRNA	Experiments	Reference
MIRT643139	hsa-miR-6779-3p	HITS-CLIP	23824327
MIRT617647	hsa-miR-4716-5p	HITS-CLIP	23824327
MIRT617646	hsa-miR-1470	HITS-CLIP	23824327
MIRT617645	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT661713	hsa-miR-7976	HITS-CLIP	23824327
MIRT617644	hsa-miR-3909	HITS-CLIP	23824327
MIRT617643	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT617642	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT643139	hsa-miR-6779-3p	HITS-CLIP	23824327
MIRT617647	hsa-miR-4716-5p	HITS-CLIP	23824327
MIRT617646	hsa-miR-1470	HITS-CLIP	23824327
MIRT617645	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT617644	hsa-miR-3909	HITS-CLIP	23824327
MIRT617643	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT617642	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT625246	hsa-miR-3912-5p	HITS-CLIP	23824327
MIRT617646	hsa-miR-1470	HITS-CLIP	23824327
MIRT617645	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT617644	hsa-miR-3909	HITS-CLIP	23824327
MIRT617643	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT617642	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT617647	hsa-miR-4716-5p	HITS-CLIP	23824327
MIRT617646	hsa-miR-1470	HITS-CLIP	23824327
MIRT617645	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT625247	hsa-miR-4469	HITS-CLIP	23824327
MIRT617644	hsa-miR-3909	HITS-CLIP	23824327
MIRT617643	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT617642	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT625246	hsa-miR-3912-5p	HITS-CLIP	23824327
MIRT617647	hsa-miR-4716-5p	HITS-CLIP	23824327
MIRT617646	hsa-miR-1470	HITS-CLIP	23824327
MIRT617645	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT617644	hsa-miR-3909	HITS-CLIP	23824327
MIRT617643	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT617642	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT643139	hsa-miR-6779-3p	HITS-CLIP	23824327
MIRT617647	hsa-miR-4716-5p	HITS-CLIP	23824327
MIRT617646	hsa-miR-1470	HITS-CLIP	23824327
MIRT617645	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT661713	hsa-miR-7976	HITS-CLIP	23824327
MIRT617644	hsa-miR-3909	HITS-CLIP	23824327
MIRT617643	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT617642	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT643139	hsa-miR-6779-3p	HITS-CLIP	23824327
MIRT617647	hsa-miR-4716-5p	HITS-CLIP	23824327
MIRT617646	hsa-miR-1470	HITS-CLIP	23824327
MIRT617645	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT617644	hsa-miR-3909	HITS-CLIP	23824327
MIRT617643	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT617642	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT625246	hsa-miR-3912-5p	HITS-CLIP	23824327
MIRT617646	hsa-miR-1470	HITS-CLIP	23824327
MIRT617645	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT617644	hsa-miR-3909	HITS-CLIP	23824327
MIRT617643	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT617642	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT617647	hsa-miR-4716-5p	HITS-CLIP	23824327
MIRT617646	hsa-miR-1470	HITS-CLIP	23824327
MIRT617645	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT625247	hsa-miR-4469	HITS-CLIP	23824327
MIRT617644	hsa-miR-3909	HITS-CLIP	23824327
MIRT617643	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT617642	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT625246	hsa-miR-3912-5p	HITS-CLIP	23824327
MIRT617647	hsa-miR-4716-5p	HITS-CLIP	23824327
MIRT617646	hsa-miR-1470	HITS-CLIP	23824327
MIRT617645	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT617644	hsa-miR-3909	HITS-CLIP	23824327
MIRT617643	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT617642	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT1284888	hsa-miR-1182	CLIP-seq
MIRT1284889	hsa-miR-1205	CLIP-seq
MIRT1284890	hsa-miR-1291	CLIP-seq
MIRT1284891	hsa-miR-146b-3p	CLIP-seq
MIRT1284892	hsa-miR-1909	CLIP-seq
MIRT1284893	hsa-miR-3173-5p	CLIP-seq
MIRT1284894	hsa-miR-3691-3p	CLIP-seq
MIRT1284895	hsa-miR-4645-5p	CLIP-seq
MIRT1284896	hsa-miR-4673	CLIP-seq
MIRT1284897	hsa-miR-593	CLIP-seq
MIRT1284898	hsa-miR-615-5p	CLIP-seq
MIRT1284899	hsa-miR-1208	CLIP-seq
MIRT1284900	hsa-miR-125a-3p	CLIP-seq
MIRT1284901	hsa-miR-128	CLIP-seq
MIRT1284902	hsa-miR-143	CLIP-seq
MIRT1284903	hsa-miR-1915	CLIP-seq
MIRT1284904	hsa-miR-2117	CLIP-seq
MIRT1284905	hsa-miR-24	CLIP-seq
MIRT1284906	hsa-miR-27a	CLIP-seq
MIRT1284907	hsa-miR-27b	CLIP-seq
MIRT1284908	hsa-miR-3065-5p	CLIP-seq
MIRT1284909	hsa-miR-3117-5p	CLIP-seq
MIRT1284910	hsa-miR-3125	CLIP-seq
MIRT1284911	hsa-miR-3180-5p	CLIP-seq
MIRT1284912	hsa-miR-3190	CLIP-seq
MIRT1284913	hsa-miR-3916	CLIP-seq
MIRT1284914	hsa-miR-425	CLIP-seq
MIRT1284915	hsa-miR-4273	CLIP-seq
MIRT1284916	hsa-miR-4284	CLIP-seq
MIRT1284917	hsa-miR-4496	CLIP-seq
MIRT1284918	hsa-miR-455-3p	CLIP-seq
MIRT1284895	hsa-miR-4645-5p	CLIP-seq
MIRT1284896	hsa-miR-4673	CLIP-seq
MIRT1284919	hsa-miR-4712-3p	CLIP-seq
MIRT1284920	hsa-miR-4726-3p	CLIP-seq
MIRT1284921	hsa-miR-4763-5p	CLIP-seq
MIRT1284922	hsa-miR-4770	CLIP-seq
MIRT1284923	hsa-miR-4792	CLIP-seq
MIRT1284924	hsa-miR-4795-5p	CLIP-seq
MIRT1284925	hsa-miR-553	CLIP-seq
MIRT1284926	hsa-miR-596	CLIP-seq
MIRT1284927	hsa-miR-1237	CLIP-seq
MIRT1284928	hsa-miR-1252	CLIP-seq
MIRT1284929	hsa-miR-3127-3p	CLIP-seq
MIRT1284930	hsa-miR-3157-5p	CLIP-seq
MIRT1284931	hsa-miR-339-5p	CLIP-seq
MIRT1284932	hsa-miR-3607-5p	CLIP-seq
MIRT1284933	hsa-miR-3611	CLIP-seq
MIRT1284934	hsa-miR-3622a-3p	CLIP-seq
MIRT1284935	hsa-miR-3622b-3p	CLIP-seq
MIRT1284936	hsa-miR-3914	CLIP-seq
MIRT1284937	hsa-miR-4256	CLIP-seq
MIRT1284938	hsa-miR-4267	CLIP-seq
MIRT1284939	hsa-miR-4323	CLIP-seq
MIRT1284940	hsa-miR-4501	CLIP-seq
MIRT1284941	hsa-miR-4521	CLIP-seq
MIRT1284942	hsa-miR-4530	CLIP-seq
MIRT1284943	hsa-miR-4690-3p	CLIP-seq
MIRT1284944	hsa-miR-4749-3p	CLIP-seq
MIRT1284945	hsa-miR-591	CLIP-seq
MIRT1284946	hsa-miR-766	CLIP-seq
MIRT1284947	hsa-miR-922	CLIP-seq
MIRT1284948	hsa-miR-105	CLIP-seq
MIRT1284901	hsa-miR-128	CLIP-seq
MIRT1284905	hsa-miR-24	CLIP-seq
MIRT1284906	hsa-miR-27a	CLIP-seq
MIRT1284907	hsa-miR-27b	CLIP-seq
MIRT1284949	hsa-miR-3136-5p	CLIP-seq
MIRT1284912	hsa-miR-3190	CLIP-seq
MIRT1284916	hsa-miR-4284	CLIP-seq
MIRT1284950	hsa-miR-4439	CLIP-seq
MIRT1284951	hsa-miR-4513	CLIP-seq
MIRT1284918	hsa-miR-455-3p	CLIP-seq
MIRT1284952	hsa-miR-4694-3p	CLIP-seq
MIRT1284924	hsa-miR-4795-5p	CLIP-seq
MIRT1284953	hsa-miR-877	CLIP-seq
MIRT1284901	hsa-miR-128	CLIP-seq
MIRT1284953	hsa-miR-877	CLIP-seq
MIRT1284928	hsa-miR-1252	CLIP-seq
MIRT1284901	hsa-miR-128	CLIP-seq
MIRT1921280	hsa-miR-1908	CLIP-seq
MIRT1921281	hsa-miR-3960	CLIP-seq
MIRT1921282	hsa-miR-4271	CLIP-seq
MIRT1921283	hsa-miR-4467	CLIP-seq
MIRT1921284	hsa-miR-4533	CLIP-seq
MIRT1921285	hsa-miR-4725-3p	CLIP-seq
MIRT1921286	hsa-miR-4747-5p	CLIP-seq
MIRT1921287	hsa-miR-625	CLIP-seq
MIRT1921288	hsa-miR-663	CLIP-seq
MIRT1284901	hsa-miR-128	CLIP-seq
MIRT1284905	hsa-miR-24	CLIP-seq
MIRT1284906	hsa-miR-27a	CLIP-seq
MIRT1284907	hsa-miR-27b	CLIP-seq
MIRT1284912	hsa-miR-3190	CLIP-seq
MIRT1284916	hsa-miR-4284	CLIP-seq
MIRT1284918	hsa-miR-455-3p	CLIP-seq
MIRT1284924	hsa-miR-4795-5p	CLIP-seq
MIRT2084582	hsa-miR-1229	CLIP-seq
MIRT2084583	hsa-miR-4308	CLIP-seq
MIRT2084584	hsa-miR-4317	CLIP-seq
MIRT2084585	hsa-miR-587	CLIP-seq
MIRT2309793	hsa-miR-4492	CLIP-seq
MIRT2309794	hsa-miR-4498	CLIP-seq
MIRT2309795	hsa-miR-762	CLIP-seq
MIRT2309796	hsa-miR-149	CLIP-seq
MIRT2084585	hsa-miR-587	CLIP-seq
MIRT2457645	hsa-miR-15a	CLIP-seq
MIRT2457646	hsa-miR-15b	CLIP-seq
MIRT2457647	hsa-miR-16	CLIP-seq
MIRT2457648	hsa-miR-195	CLIP-seq
MIRT2457649	hsa-miR-3978	CLIP-seq
MIRT2457650	hsa-miR-424	CLIP-seq
MIRT2457651	hsa-miR-4292	CLIP-seq
MIRT2084583	hsa-miR-4308	CLIP-seq
MIRT2457652	hsa-miR-497	CLIP-seq
MIRT2457653	hsa-miR-642b	CLIP-seq
MIRT2457654	hsa-miR-875-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IBA
GO:0000139	Component	Golgi membrane	IDA	16086013
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	17562788, 24891604
GO:0003924	Function	GTPase activity	IEA
GO:0003925	Function	G protein activity	IMP	16086013, 17562788, 29069590
GO:0005515	Function	Protein binding	IPI	16086013, 17562788, 24891604, 25277244
GO:0005525	Function	GTP binding	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	29069590
GO:0005794	Component	Golgi apparatus	IDA	17562788
GO:0005794	Component	Golgi apparatus	IEA
GO:0006886	Process	Intracellular protein transport	IBA
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IMP	29069590
GO:0007030	Process	Golgi organization	IMP	17684057
GO:0012505	Component	Endomembrane system	IBA
GO:0016020	Component	Membrane	IEA
GO:0019068	Process	Virion assembly	IMP	21680502
GO:0030670	Component	Phagocytic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032588	Component	Trans-Golgi network membrane	TAS
GO:0033106	Component	Cis-Golgi network membrane	IDA	29069590
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	IDA	29069590
GO:0035526	Process	Retrograde transport, plasma membrane to Golgi	IMP	17562788
GO:0045335	Component	Phagocytic vesicle	IDA	21255211
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0071346	Process	Cellular response to type II interferon	IEA
GO:0090382	Process	Phagosome maturation	IMP	21255211
GO:1903358	Process	Regulation of Golgi organization	IMP	18664496

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q86YS6
• Protein name: Ras-related protein Rab-43 (Ras-related protein Rab-41)
• Protein function: The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to r
• PDB: 2HUP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	20 → 182	Ras family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed in brain, testis, lung, heart, ovary, colon, kidney, uterus and spleen but not in liver. {ECO:0000269|PubMed:15018353}.
• Sequence:

  MAGPGPGPGDPDEQYDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGSTIGVDFTMKTL
  EIQGKRVKLQIWDTAGQERFRTITQSYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYA
  GSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATEL
  IMRHGGPLFSEKSPDHIQLNSKDIGEGWGCGC

• Sequence length: 212

Pathways

Reactome Pathway

Retrograde transport at the Trans-Golgi-Network

RAB geranylgeranylation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
RAB43-related disorder	Likely benign; Uncertain significance; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (37)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	30295752, 30786962		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	31802299		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	24373285	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31226964, 35596159	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36359911	Inhibit	★☆☆☆☆ Found in Text Mining only
Clinodactyly	Clinodactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clinodactyly of fingers	Clinodactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31226964		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31226964	Associate	★☆☆☆☆ Found in Text Mining only
Congenital clubfoot	Congenital Clubfoot	HPO_DG			★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33534780, 36525280	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	29106825	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29036407		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28075478		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperopia	Hyperopia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	29106825		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG	29106825		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	29106825	Associate	★☆☆☆☆ Found in Text Mining only
Long Qt Syndrome 2	Long qt syndrome	Pubtator	23864605	Associate	★☆☆☆☆ Found in Text Mining only
Long Qt Syndrome 2	Long QT Syndrome	BEFREE	23864605		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31226964		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31226964		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	29106825	Associate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27819876, 31388861		★☆☆☆☆ Found in Text Mining only
NEURODEVELOPMENTAL DISORDER WITH ATAXIC GAIT, ABSENT SPEECH, AND DECREASED CORTICAL WHITE MATTER	Neurodevelopmental Disorder With Ataxic Gait, Absent Speech, And Decreased Cortical White Matter	GENOMICS_ENGLAND_DG	29106825		★☆☆☆☆ Found in Text Mining only
NEURODEVELOPMENTAL DISORDER WITH ATAXIC GAIT, ABSENT SPEECH, AND DECREASED CORTICAL WHITE MATTER	Neurodevelopmental Disorder With Ataxic Gait, Absent Speech, And Decreased Cortical White Matter	UNIPROT_DG	29106825		★☆☆☆☆ Found in Text Mining only
NEURODEVELOPMENTAL DISORDER WITH ATAXIC GAIT, ABSENT SPEECH, AND DECREASED CORTICAL WHITE MATTER	Neurodevelopmental Disorder With Ataxic Gait, Absent Speech, And Decreased Cortical White Matter	CLINVAR_DG	29106825		★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29928484		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	27889822, 31593484, 31729964		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33660438, 38017579	Associate	★☆☆☆☆ Found in Text Mining only
Stereotyped Behavior	Stereotyped Behavior	HPO_DG			★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	29106825	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

RAB9B 2 shared pathwaysRetrograde transport at the Trans-Golgi-Network, RAB geranylgeranylation Related via 2 shared pathways including Retrograde transport at the Trans-Golgi-Network, RAB geranylgeranylation. RAB6B 2 shared pathwaysRetrograde transport at the Trans-Golgi-Network, RAB geranylgeranylation Related via 2 shared pathways including Retrograde transport at the Trans-Golgi-Network, RAB geranylgeranylation. RAB6A 2 shared pathwaysRetrograde transport at the Trans-Golgi-Network, RAB geranylgeranylation Related via 2 shared pathways including Retrograde transport at the Trans-Golgi-Network, RAB geranylgeranylation. RAB9A 2 shared pathwaysRetrograde transport at the Trans-Golgi-Network, RAB geranylgeranylation Related via 2 shared pathways including Retrograde transport at the Trans-Golgi-Network, RAB geranylgeranylation.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
RAB9B	0	[]	2	["Retrograde transport at the Trans-Golgi-Network","RAB geranylgeranylation"]	0	[]
RAB6B	0	[]	2	["Retrograde transport at the Trans-Golgi-Network","RAB geranylgeranylation"]	0	[]
RAB6A	0	[]	2	["Retrograde transport at the Trans-Golgi-Network","RAB geranylgeranylation"]	0	[]
RAB9A	0	[]	2	["Retrograde transport at the Trans-Golgi-Network","RAB geranylgeranylation"]	0	[]

Diseases Linked via Similar Genes

Auditory neuropathy Linked via 1 of 4 related genesRAB9B Intellectual developmental disorder Linked via 1 of 4 related genesRAB9B Pelizaeus-merzbacher disease Linked via 1 of 4 related genesRAB9B Spastic paraplegia, x-linked Linked via 1 of 4 related genesRAB9B Hereditary spastic paraplegia Linked via 1 of 4 related genesRAB9B

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Auditory neuropathy	1	["RAB9B"]
Intellectual developmental disorder	1	["RAB9B"]
Pelizaeus-merzbacher disease	1	["RAB9B"]
Spastic paraplegia, x-linked	1	["RAB9B"]
Hereditary spastic paraplegia	1	["RAB9B"]