PRKG2 (protein kinase cGMP-dependent 2)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5593
• Gene name: Protein kinase cGMP-dependent 2
• Gene symbol: PRKG2
• Synonyms (NCBI Gene): AMD4, PKG2, PRKGR2, SMDP, cGK2, cGKII
• Chromosome: 4
• Chromosome location: 4q21.21
• Summary: This gene encodes a protein that belongs to the serine/threonine protein kinase family of proteins. The encoded protein binds to and inhibits the activation of several receptor tyrosine kinases. The membrane-bound protein is a regulator of intestinal secr

miRNA Show/Hide all (122)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018075	hsa-miR-335-5p	Microarray	18185580
MIRT023857	hsa-miR-1-3p	Microarray	18668037
MIRT618399	hsa-miR-548a-5p	HITS-CLIP	23824327
MIRT618398	hsa-miR-548ab	HITS-CLIP	23824327
MIRT618397	hsa-miR-548ad-5p	HITS-CLIP	23824327
MIRT618396	hsa-miR-548ae-5p	HITS-CLIP	23824327
MIRT618395	hsa-miR-548ak	HITS-CLIP	23824327
MIRT618394	hsa-miR-548am-5p	HITS-CLIP	23824327
MIRT618393	hsa-miR-548ap-5p	HITS-CLIP	23824327
MIRT618392	hsa-miR-548aq-5p	HITS-CLIP	23824327
MIRT618391	hsa-miR-548ar-5p	HITS-CLIP	23824327
MIRT618390	hsa-miR-548as-5p	HITS-CLIP	23824327
MIRT618389	hsa-miR-548au-5p	HITS-CLIP	23824327
MIRT618388	hsa-miR-548ay-5p	HITS-CLIP	23824327
MIRT618387	hsa-miR-548b-5p	HITS-CLIP	23824327
MIRT618386	hsa-miR-548bb-5p	HITS-CLIP	23824327
MIRT618385	hsa-miR-548c-5p	HITS-CLIP	23824327
MIRT618384	hsa-miR-548d-5p	HITS-CLIP	23824327
MIRT618383	hsa-miR-548h-5p	HITS-CLIP	23824327
MIRT618382	hsa-miR-548i	HITS-CLIP	23824327
MIRT618381	hsa-miR-548j-5p	HITS-CLIP	23824327
MIRT618380	hsa-miR-548o-5p	HITS-CLIP	23824327
MIRT618379	hsa-miR-548w	HITS-CLIP	23824327
MIRT618378	hsa-miR-548y	HITS-CLIP	23824327
MIRT618377	hsa-miR-559	HITS-CLIP	23824327
MIRT618376	hsa-miR-548av-5p	HITS-CLIP	23824327
MIRT618375	hsa-miR-548k	HITS-CLIP	23824327
MIRT618374	hsa-miR-8054	HITS-CLIP	23824327
MIRT618373	hsa-miR-548l	HITS-CLIP	23824327
MIRT618372	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT618371	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT618370	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT618369	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT618399	hsa-miR-548a-5p	HITS-CLIP	23824327
MIRT618398	hsa-miR-548ab	HITS-CLIP	23824327
MIRT618397	hsa-miR-548ad-5p	HITS-CLIP	23824327
MIRT618396	hsa-miR-548ae-5p	HITS-CLIP	23824327
MIRT618395	hsa-miR-548ak	HITS-CLIP	23824327
MIRT618394	hsa-miR-548am-5p	HITS-CLIP	23824327
MIRT618393	hsa-miR-548ap-5p	HITS-CLIP	23824327
MIRT618392	hsa-miR-548aq-5p	HITS-CLIP	23824327
MIRT618391	hsa-miR-548ar-5p	HITS-CLIP	23824327
MIRT618390	hsa-miR-548as-5p	HITS-CLIP	23824327
MIRT618389	hsa-miR-548au-5p	HITS-CLIP	23824327
MIRT618388	hsa-miR-548ay-5p	HITS-CLIP	23824327
MIRT618387	hsa-miR-548b-5p	HITS-CLIP	23824327
MIRT618386	hsa-miR-548bb-5p	HITS-CLIP	23824327
MIRT618385	hsa-miR-548c-5p	HITS-CLIP	23824327
MIRT618384	hsa-miR-548d-5p	HITS-CLIP	23824327
MIRT618383	hsa-miR-548h-5p	HITS-CLIP	23824327
MIRT618382	hsa-miR-548i	HITS-CLIP	23824327
MIRT618381	hsa-miR-548j-5p	HITS-CLIP	23824327
MIRT618380	hsa-miR-548o-5p	HITS-CLIP	23824327
MIRT618379	hsa-miR-548w	HITS-CLIP	23824327
MIRT618378	hsa-miR-548y	HITS-CLIP	23824327
MIRT618377	hsa-miR-559	HITS-CLIP	23824327
MIRT618376	hsa-miR-548av-5p	HITS-CLIP	23824327
MIRT618375	hsa-miR-548k	HITS-CLIP	23824327
MIRT618374	hsa-miR-8054	HITS-CLIP	23824327
MIRT618373	hsa-miR-548l	HITS-CLIP	23824327
MIRT618372	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT618371	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT618370	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT618369	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT1263666	hsa-miR-1267	CLIP-seq
MIRT1263667	hsa-miR-185	CLIP-seq
MIRT1263668	hsa-miR-298	CLIP-seq
MIRT1263669	hsa-miR-3678-3p	CLIP-seq
MIRT1263670	hsa-miR-4306	CLIP-seq
MIRT1263671	hsa-miR-4428	CLIP-seq
MIRT1263672	hsa-miR-4644	CLIP-seq
MIRT1263673	hsa-miR-4652-3p	CLIP-seq
MIRT1263674	hsa-miR-548a-3p	CLIP-seq
MIRT1263675	hsa-miR-548ae	CLIP-seq
MIRT1263676	hsa-miR-548aj	CLIP-seq
MIRT1263677	hsa-miR-548am	CLIP-seq
MIRT1263678	hsa-miR-548e	CLIP-seq
MIRT1263679	hsa-miR-548f	CLIP-seq
MIRT1263680	hsa-miR-548x	CLIP-seq
MIRT1263681	hsa-miR-578	CLIP-seq
MIRT2077600	hsa-miR-4496	CLIP-seq
MIRT2077601	hsa-miR-651	CLIP-seq
MIRT2304149	hsa-miR-3647-3p	CLIP-seq
MIRT2304150	hsa-miR-4729	CLIP-seq
MIRT2601115	hsa-miR-1251	CLIP-seq
MIRT2601116	hsa-miR-219-5p	CLIP-seq
MIRT2601117	hsa-miR-3190	CLIP-seq
MIRT2601118	hsa-miR-3920	CLIP-seq
MIRT2601119	hsa-miR-3978	CLIP-seq
MIRT2601120	hsa-miR-4252	CLIP-seq
MIRT2601121	hsa-miR-4274	CLIP-seq
MIRT2601122	hsa-miR-4445	CLIP-seq
MIRT2601123	hsa-miR-4519	CLIP-seq
MIRT2601124	hsa-miR-4752	CLIP-seq
MIRT2601125	hsa-miR-4782-3p	CLIP-seq
MIRT2601126	hsa-miR-495	CLIP-seq
MIRT2601127	hsa-miR-508-3p	CLIP-seq
MIRT2601128	hsa-miR-539	CLIP-seq
MIRT2601129	hsa-miR-580	CLIP-seq
MIRT2601130	hsa-miR-760	CLIP-seq
MIRT2601115	hsa-miR-1251	CLIP-seq
MIRT2688647	hsa-miR-2054	CLIP-seq
MIRT2601116	hsa-miR-219-5p	CLIP-seq
MIRT2601117	hsa-miR-3190	CLIP-seq
MIRT2688648	hsa-miR-374c	CLIP-seq
MIRT2688649	hsa-miR-380	CLIP-seq
MIRT2601118	hsa-miR-3920	CLIP-seq
MIRT2601119	hsa-miR-3978	CLIP-seq
MIRT2601120	hsa-miR-4252	CLIP-seq
MIRT2601121	hsa-miR-4274	CLIP-seq
MIRT2601122	hsa-miR-4445	CLIP-seq
MIRT2601123	hsa-miR-4519	CLIP-seq
MIRT2601124	hsa-miR-4752	CLIP-seq
MIRT2601125	hsa-miR-4782-3p	CLIP-seq
MIRT2601126	hsa-miR-495	CLIP-seq
MIRT2688650	hsa-miR-499-3p	CLIP-seq
MIRT2688651	hsa-miR-499a-3p	CLIP-seq
MIRT2601127	hsa-miR-508-3p	CLIP-seq
MIRT2601128	hsa-miR-539	CLIP-seq
MIRT2601129	hsa-miR-580	CLIP-seq
MIRT2688652	hsa-miR-655	CLIP-seq
MIRT2601130	hsa-miR-760	CLIP-seq

Gene ontology (GO) Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	8607838
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004692	Function	CGMP-dependent protein kinase activity	IEA
GO:0004692	Function	CGMP-dependent protein kinase activity	IMP	33106379
GO:0004692	Function	CGMP-dependent protein kinase activity	TAS
GO:0005524	Function	ATP binding	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006468	Process	Protein phosphorylation	IMP	15905169, 33106379
GO:0006468	Process	Protein phosphorylation	TAS	8607838
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	IMP	33106379
GO:0007165	Process	Signal transduction	TAS	8607838
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030553	Function	CGMP binding	IEA
GO:0031965	Component	Nuclear membrane	IEA
GO:0032332	Process	Positive regulation of chondrocyte differentiation	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0046146	Process	Tetrahydrobiopterin metabolic process	TAS
GO:0051019	Function	Mitogen-activated protein kinase binding	IMP	33106379
GO:0072659	Process	Protein localization to plasma membrane	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106310	Function	Protein serine kinase activity	IMP	33106379
GO:1903829	Process	Positive regulation of protein localization	IEA
GO:2001226	Process	Negative regulation of chloride transport	IEA

Other IDs

• MIM: 601591
• HGNC: 9416
• e!Ensembl: ENSG00000138669

Protein

• UniProt ID: Q13237
• Protein name: cGMP-dependent protein kinase 2 (cGK 2) (cGK2) (EC 2.7.11.12) (cGMP-dependent protein kinase II) (cGKII)
• Protein function: Crucial regulator of intestinal secretion and bone growth. Phosphorylates and activates CFTR on the plasma membrane. Plays a key role in intestinal secretion by regulating cGMP-dependent translocation of CFTR in jejunum (PubMed:33106379). Acts d
• PDB: 5BV6 , 5C6C , 5C8W , 5JIX , 5JIZ , 6BQ8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00027	cNMP_binding	304 → 393	Cyclic nucleotide-binding domain	Domain
  PF00027	cNMP_binding	186 → 269	Cyclic nucleotide-binding domain	Domain
  PF00069	Pkinase	453 → 711	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly concentrated in brain, lung and intestinal mucosa.
• Sequence:

  MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYHLKELREQLSK
  QTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRG
  AKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDM
  VECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNC
  TRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIID
  CLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKAL
  ISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRS
  MSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAFA
  MKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWS
  ILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKK
  IGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYN
  LILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLK
  ARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF

• Sequence length: 762

Pathways

KEGG Pathway	Reactome Pathway
cGMP-PKG signaling pathway	Tetrahydrobiopterin (BH4) synthesis, recycling, salvage and regulation
Hormone signaling	cGMP effects
Gap junction
Platelet activation
Circadian entrainment
Thermogenesis
Long-term depression
Olfactory transduction
Regulation of lipolysis in adipocytes
Renin secretion
Salivary secretion

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Acromesomelic dysplasia 4	Pathogenic; Likely pathogenic	rs1291510415, rs2110087773, rs2546101657, rs995285513	RCV001786318 RCV001786319 RCV003228231 RCV003228694	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Spondylometaphyseal dysplasia, pagnamenta type	Pathogenic	rs2109933573	RCV001786320	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (13)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	40645996	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	35835914	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	40205036	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	40205036	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	40205036	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRKG2-related disorder	Likely benign; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	33169155, 35396580, 39753749	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPONDYLOMETAPHYSEAL DYSPLASIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (24)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acromesomelic dysplasia	Acromesomelic dysplasia	Pubtator	33887582	Associate	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	19543319		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	19543319	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22556146, 29028532		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	23233742	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29587280		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	29587280		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19543319	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19543319		★☆☆☆☆ Found in Text Mining only
Gout	Gout	BEFREE	18678579		★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	32124961	Associate	★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	18678579		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	27604828		★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	28412213		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22556146, 29028532		★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	33663081	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	18166785		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	LHGDN	18262053		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	18262053		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19543319		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29914933		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29617357		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	29617357	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PLCB3 1 shared diseaseSpondylometaphyseal dysplasia 8 shared pathwayscGMP-PKG signaling pathway, Hormone signaling, Gap junction, Platelet activation, Circadian entrainment, Long-term depression, Renin secretion, Salivary secretion 3 shared evidence sourcesDisgenet (Spondylometaphyseal dysplasia), ClinVar (Spondylometaphyseal dysplasia), HPO (Spondylometaphyseal dysplasia) Related via 8 shared pathways including cGMP-PKG signaling pathway, Hormone signaling — evidence mostly Disgenet. PRKG1 10 shared pathwayscGMP-PKG signaling pathway, Hormone signaling, Gap junction, Platelet activation, Circadian entrainment, Thermogenesis, Long-term depression, Regulation of lipolysis in adipocytes, Salivary secretion, cGMP effects Related via 10 shared pathways including cGMP-PKG signaling pathway, Hormone signaling. PAM16 1 shared diseaseSpondylometaphyseal dysplasia 3 shared evidence sourcesDisgenet (Spondylometaphyseal dysplasia), ClinVar (Spondylometaphyseal dysplasia), HPO (Spondylometaphyseal dysplasia) Related via 1 shared disease including Spondylometaphyseal dysplasia — evidence mostly Disgenet. GUCY1A2 7 shared pathwayscGMP-PKG signaling pathway, Gap junction, Platelet activation, Circadian entrainment, Long-term depression, Renin secretion, Salivary secretion Related via 7 shared pathways including cGMP-PKG signaling pathway, Gap junction. GUCY1A1 7 shared pathwayscGMP-PKG signaling pathway, Gap junction, Platelet activation, Circadian entrainment, Long-term depression, Renin secretion, Salivary secretion Related via 7 shared pathways including cGMP-PKG signaling pathway, Gap junction.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PLCB3	1	["Spondylometaphyseal dysplasia"]	8	["cGMP-PKG signaling pathway","Hormone signaling","Gap junction","Platelet activation","Circadian entrainment","Long-term depression","Renin secretion","Salivary secretion"]	3	["Disgenet (Spondylometaphyseal dysplasia)","ClinVar (Spondylometaphyseal dysplasia)","HPO (Spondylometaphyseal dysplasia)"]
PRKG1	0	[]	10	["cGMP-PKG signaling pathway","Hormone signaling","Gap junction","Platelet activation","Circadian entrainment","Thermogenesis","Long-term depression","Regulation of lipolysis in adipocytes","Salivary secretion","cGMP effects"]	0	[]
PAM16	1	["Spondylometaphyseal dysplasia"]	0	[]	3	["Disgenet (Spondylometaphyseal dysplasia)","ClinVar (Spondylometaphyseal dysplasia)","HPO (Spondylometaphyseal dysplasia)"]
GUCY1A2	0	[]	7	["cGMP-PKG signaling pathway","Gap junction","Platelet activation","Circadian entrainment","Long-term depression","Renin secretion","Salivary secretion"]	0	[]
GUCY1A1	0	[]	7	["cGMP-PKG signaling pathway","Gap junction","Platelet activation","Circadian entrainment","Long-term depression","Renin secretion","Salivary secretion"]	0	[]

Diseases Linked via Similar Genes

Coronary artery disease Linked via 3 of 5 related genesPRKG1, GUCY1A2, GUCY1A1 Hypertension Linked via 2 of 5 related genesPLCB3, GUCY1A1 Diabetes mellitus type 2 Linked via 2 of 5 related genesPLCB3, PRKG1 Autism Linked via 2 of 5 related genesPRKG1, GUCY1A2 Obesity Linked via 2 of 5 related genesPRKG1, GUCY1A2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Coronary artery disease	3	["PRKG1","GUCY1A2","GUCY1A1"]
Hypertension	2	["PLCB3","GUCY1A1"]
Diabetes mellitus type 2	2	["PLCB3","PRKG1"]
Autism	2	["PRKG1","GUCY1A2"]
Obesity	2	["PRKG1","GUCY1A2"]