PRKAR2A (protein kinase cAMP-dependent type II regulatory subunit alpha)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5576
• Gene name: Protein kinase cAMP-dependent type II regulatory subunit alpha
• Gene symbol: PRKAR2A
• Synonyms (NCBI Gene): PKR2, PRKAR2
• Chromosome: 3
• Chromosome location: 3p21.31
• Summary: cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holo

miRNA Show/Hide all (577)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004218	hsa-miR-197-3p	Microarray	16822819
MIRT020699	hsa-miR-155-5p	Proteomics	18668040
MIRT027082	hsa-miR-103a-3p	Sequencing	20371350
MIRT031655	hsa-miR-16-5p	Sequencing	20371350
MIRT032313	hsa-let-7b-5p	Proteomics	18668040
MIRT039067	hsa-miR-769-3p	CLASH	23622248
MIRT052717	hsa-miR-1260b	CLASH	23622248
MIRT627828	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT627827	hsa-miR-6777-3p	HITS-CLIP	23824327
MIRT627826	hsa-miR-6840-3p	HITS-CLIP	23824327
MIRT627825	hsa-miR-1915-3p	HITS-CLIP	23824327
MIRT627824	hsa-miR-6764-5p	HITS-CLIP	23824327
MIRT627823	hsa-miR-4726-3p	HITS-CLIP	23824327
MIRT627822	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT627821	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT654767	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT654766	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT654765	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT654764	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT654763	hsa-miR-378g	HITS-CLIP	23824327
MIRT654762	hsa-miR-6815-3p	HITS-CLIP	23824327
MIRT654761	hsa-miR-4437	HITS-CLIP	23824327
MIRT654760	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT654759	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT654758	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT654757	hsa-miR-4674	HITS-CLIP	23824327
MIRT627828	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT627827	hsa-miR-6777-3p	HITS-CLIP	23824327
MIRT627826	hsa-miR-6840-3p	HITS-CLIP	23824327
MIRT627825	hsa-miR-1915-3p	HITS-CLIP	23824327
MIRT627824	hsa-miR-6764-5p	HITS-CLIP	23824327
MIRT627823	hsa-miR-4726-3p	HITS-CLIP	23824327
MIRT627822	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT627821	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT485219	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT485218	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT031655	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT485217	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT485216	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT485214	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT485215	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT485212	hsa-miR-6758-5p	PAR-CLIP	20371350
MIRT485213	hsa-miR-6856-5p	PAR-CLIP	20371350
MIRT485211	hsa-miR-3125	PAR-CLIP	20371350
MIRT485210	hsa-miR-3916	PAR-CLIP	20371350
MIRT485209	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT485208	hsa-miR-451b	PAR-CLIP	20371350
MIRT485207	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT485206	hsa-miR-646	PAR-CLIP	20371350
MIRT485205	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT485204	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT485219	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT485218	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT031655	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT485217	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT485216	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT485214	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT485215	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT485212	hsa-miR-6758-5p	PAR-CLIP	20371350
MIRT485213	hsa-miR-6856-5p	PAR-CLIP	20371350
MIRT485211	hsa-miR-3125	PAR-CLIP	20371350
MIRT485210	hsa-miR-3916	PAR-CLIP	20371350
MIRT485209	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT485208	hsa-miR-451b	PAR-CLIP	20371350
MIRT485207	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT485206	hsa-miR-646	PAR-CLIP	20371350
MIRT485205	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT485204	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT485219	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT485218	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT031655	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT485217	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT485216	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT485214	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT485215	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT485212	hsa-miR-6758-5p	PAR-CLIP	20371350
MIRT485213	hsa-miR-6856-5p	PAR-CLIP	20371350
MIRT485211	hsa-miR-3125	PAR-CLIP	20371350
MIRT485210	hsa-miR-3916	PAR-CLIP	20371350
MIRT485209	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT485208	hsa-miR-451b	PAR-CLIP	20371350
MIRT485207	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT485206	hsa-miR-646	PAR-CLIP	20371350
MIRT485205	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT485204	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT485219	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT485218	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT031655	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT485217	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT485216	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT485214	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT485215	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT485212	hsa-miR-6758-5p	PAR-CLIP	20371350
MIRT485213	hsa-miR-6856-5p	PAR-CLIP	20371350
MIRT485211	hsa-miR-3125	PAR-CLIP	20371350
MIRT485210	hsa-miR-3916	PAR-CLIP	20371350
MIRT485209	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT485208	hsa-miR-451b	PAR-CLIP	20371350
MIRT485207	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT485206	hsa-miR-646	PAR-CLIP	20371350
MIRT485205	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT485204	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT485219	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT485218	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT031655	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT485217	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT485216	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT485214	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT485215	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT506033	hsa-miR-548e-5p	PAR-CLIP	21572407
MIRT485211	hsa-miR-3125	PAR-CLIP	21572407
MIRT485210	hsa-miR-3916	PAR-CLIP	21572407
MIRT485209	hsa-miR-6859-5p	PAR-CLIP	21572407
MIRT485208	hsa-miR-451b	PAR-CLIP	21572407
MIRT485207	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT485206	hsa-miR-646	PAR-CLIP	21572407
MIRT485205	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT485204	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT485219	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT485218	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT031655	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT485217	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT485216	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT485214	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT485215	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT506033	hsa-miR-548e-5p	PAR-CLIP	23446348
MIRT485212	hsa-miR-6758-5p	PAR-CLIP	23446348
MIRT485213	hsa-miR-6856-5p	PAR-CLIP	23446348
MIRT485211	hsa-miR-3125	PAR-CLIP	23446348
MIRT485210	hsa-miR-3916	PAR-CLIP	23446348
MIRT485209	hsa-miR-6859-5p	PAR-CLIP	23446348
MIRT485208	hsa-miR-451b	PAR-CLIP	23446348
MIRT485207	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT485206	hsa-miR-646	PAR-CLIP	23446348
MIRT485205	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT485204	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT521686	hsa-miR-544b	PAR-CLIP	23446348
MIRT521685	hsa-miR-7162-3p	PAR-CLIP	23446348
MIRT521684	hsa-miR-4786-5p	PAR-CLIP	23446348
MIRT521683	hsa-miR-769-5p	PAR-CLIP	23446348
MIRT521682	hsa-miR-655-5p	PAR-CLIP	23446348
MIRT521681	hsa-miR-377-5p	PAR-CLIP	23446348
MIRT521680	hsa-miR-6086	PAR-CLIP	23446348
MIRT521679	hsa-miR-92a-1-5p	PAR-CLIP	23446348
MIRT521678	hsa-miR-4425	PAR-CLIP	23446348
MIRT521677	hsa-miR-3672	PAR-CLIP	23446348
MIRT521676	hsa-miR-6864-3p	PAR-CLIP	23446348
MIRT521675	hsa-miR-30c-1-3p	PAR-CLIP	23446348
MIRT521674	hsa-miR-30c-2-3p	PAR-CLIP	23446348
MIRT521673	hsa-miR-6788-5p	PAR-CLIP	23446348
MIRT521671	hsa-miR-1273h-5p	PAR-CLIP	23446348
MIRT521672	hsa-miR-30b-3p	PAR-CLIP	23446348
MIRT521670	hsa-miR-3689a-3p	PAR-CLIP	23446348
MIRT521669	hsa-miR-3689b-3p	PAR-CLIP	23446348
MIRT521668	hsa-miR-3689c	PAR-CLIP	23446348
MIRT521667	hsa-miR-6779-5p	PAR-CLIP	23446348
MIRT521666	hsa-miR-6780a-5p	PAR-CLIP	23446348
MIRT521665	hsa-miR-887-5p	PAR-CLIP	23446348
MIRT485219	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT485218	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT031655	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT485217	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT485216	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT485214	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT485215	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT485212	hsa-miR-6758-5p	PAR-CLIP	23446348
MIRT485213	hsa-miR-6856-5p	PAR-CLIP	23446348
MIRT485211	hsa-miR-3125	PAR-CLIP	23446348
MIRT485210	hsa-miR-3916	PAR-CLIP	23446348
MIRT485209	hsa-miR-6859-5p	PAR-CLIP	23446348
MIRT485208	hsa-miR-451b	PAR-CLIP	23446348
MIRT485207	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT485206	hsa-miR-646	PAR-CLIP	23446348
MIRT485205	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT485204	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT485219	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT485218	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT031655	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT485217	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT485216	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT485214	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT485215	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT506033	hsa-miR-548e-5p	PAR-CLIP	23446348
MIRT485212	hsa-miR-6758-5p	PAR-CLIP	23446348
MIRT485213	hsa-miR-6856-5p	PAR-CLIP	23446348
MIRT485211	hsa-miR-3125	PAR-CLIP	23446348
MIRT485210	hsa-miR-3916	PAR-CLIP	23446348
MIRT485209	hsa-miR-6859-5p	PAR-CLIP	23446348
MIRT485208	hsa-miR-451b	PAR-CLIP	23446348
MIRT485207	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT485206	hsa-miR-646	PAR-CLIP	23446348
MIRT485205	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT485204	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT485219	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT485218	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT031655	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT485217	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT485216	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT485214	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT485215	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT506033	hsa-miR-548e-5p	PAR-CLIP	23446348
MIRT485212	hsa-miR-6758-5p	PAR-CLIP	23446348
MIRT485213	hsa-miR-6856-5p	PAR-CLIP	23446348
MIRT485211	hsa-miR-3125	PAR-CLIP	23446348
MIRT485210	hsa-miR-3916	PAR-CLIP	23446348
MIRT485209	hsa-miR-6859-5p	PAR-CLIP	23446348
MIRT485208	hsa-miR-451b	PAR-CLIP	23446348
MIRT485207	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT485206	hsa-miR-646	PAR-CLIP	23446348
MIRT485205	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT485204	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT485219	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT485218	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT031655	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT485217	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT485216	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT485214	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT485215	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT485212	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT485213	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT485211	hsa-miR-3125	PAR-CLIP	23592263
MIRT485210	hsa-miR-3916	PAR-CLIP	23592263
MIRT485209	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT485208	hsa-miR-451b	PAR-CLIP	23592263
MIRT485207	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT485206	hsa-miR-646	PAR-CLIP	23592263
MIRT485205	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT485204	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT627826	hsa-miR-6840-3p	HITS-CLIP	27418678
MIRT627828	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT627827	hsa-miR-6777-3p	HITS-CLIP	23824327
MIRT627826	hsa-miR-6840-3p	HITS-CLIP	23824327
MIRT627825	hsa-miR-1915-3p	HITS-CLIP	23824327
MIRT627824	hsa-miR-6764-5p	HITS-CLIP	23824327
MIRT627823	hsa-miR-4726-3p	HITS-CLIP	23824327
MIRT627822	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT627821	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT654767	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT654766	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT654765	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT654764	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT654763	hsa-miR-378g	HITS-CLIP	23824327
MIRT654762	hsa-miR-6815-3p	HITS-CLIP	23824327
MIRT654761	hsa-miR-4437	HITS-CLIP	23824327
MIRT654760	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT654759	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT654758	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT654757	hsa-miR-4674	HITS-CLIP	23824327
MIRT627828	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT627827	hsa-miR-6777-3p	HITS-CLIP	23824327
MIRT627826	hsa-miR-6840-3p	HITS-CLIP	23824327
MIRT627825	hsa-miR-1915-3p	HITS-CLIP	23824327
MIRT627824	hsa-miR-6764-5p	HITS-CLIP	23824327
MIRT627823	hsa-miR-4726-3p	HITS-CLIP	23824327
MIRT627822	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT627821	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT485219	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT485218	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT031655	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT485217	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT485216	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT485214	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT485215	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT485212	hsa-miR-6758-5p	PAR-CLIP	20371350
MIRT485213	hsa-miR-6856-5p	PAR-CLIP	20371350
MIRT485211	hsa-miR-3125	PAR-CLIP	20371350
MIRT485210	hsa-miR-3916	PAR-CLIP	20371350
MIRT485209	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT485208	hsa-miR-451b	PAR-CLIP	20371350
MIRT485207	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT485206	hsa-miR-646	PAR-CLIP	20371350
MIRT485205	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT485204	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT485219	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT485218	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT031655	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT485217	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT485216	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT485214	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT485215	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT485212	hsa-miR-6758-5p	PAR-CLIP	20371350
MIRT485213	hsa-miR-6856-5p	PAR-CLIP	20371350
MIRT485211	hsa-miR-3125	PAR-CLIP	20371350
MIRT485210	hsa-miR-3916	PAR-CLIP	20371350
MIRT485209	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT485208	hsa-miR-451b	PAR-CLIP	20371350
MIRT485207	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT485206	hsa-miR-646	PAR-CLIP	20371350
MIRT485205	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT485204	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT485219	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT485218	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT031655	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT485217	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT485216	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT485214	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT485215	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT485212	hsa-miR-6758-5p	PAR-CLIP	20371350
MIRT485213	hsa-miR-6856-5p	PAR-CLIP	20371350
MIRT485211	hsa-miR-3125	PAR-CLIP	20371350
MIRT485210	hsa-miR-3916	PAR-CLIP	20371350
MIRT485209	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT485208	hsa-miR-451b	PAR-CLIP	20371350
MIRT485207	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT485206	hsa-miR-646	PAR-CLIP	20371350
MIRT485205	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT485204	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT485219	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT485218	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT031655	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT485217	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT485216	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT485214	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT485215	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT485212	hsa-miR-6758-5p	PAR-CLIP	20371350
MIRT485213	hsa-miR-6856-5p	PAR-CLIP	20371350
MIRT485211	hsa-miR-3125	PAR-CLIP	20371350
MIRT485210	hsa-miR-3916	PAR-CLIP	20371350
MIRT485209	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT485208	hsa-miR-451b	PAR-CLIP	20371350
MIRT485207	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT485206	hsa-miR-646	PAR-CLIP	20371350
MIRT485205	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT485204	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT485219	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT485218	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT031655	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT485217	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT485216	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT485214	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT485215	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT506033	hsa-miR-548e-5p	PAR-CLIP	21572407
MIRT485211	hsa-miR-3125	PAR-CLIP	21572407
MIRT485210	hsa-miR-3916	PAR-CLIP	21572407
MIRT485209	hsa-miR-6859-5p	PAR-CLIP	21572407
MIRT485208	hsa-miR-451b	PAR-CLIP	21572407
MIRT485207	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT485206	hsa-miR-646	PAR-CLIP	21572407
MIRT485205	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT485204	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT485219	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT485218	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT031655	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT485217	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT485216	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT485214	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT485215	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT506033	hsa-miR-548e-5p	PAR-CLIP	23446348
MIRT485212	hsa-miR-6758-5p	PAR-CLIP	23446348
MIRT485213	hsa-miR-6856-5p	PAR-CLIP	23446348
MIRT485211	hsa-miR-3125	PAR-CLIP	23446348
MIRT485210	hsa-miR-3916	PAR-CLIP	23446348
MIRT485209	hsa-miR-6859-5p	PAR-CLIP	23446348
MIRT485208	hsa-miR-451b	PAR-CLIP	23446348
MIRT485207	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT485206	hsa-miR-646	PAR-CLIP	23446348
MIRT485205	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT485204	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT521686	hsa-miR-544b	PAR-CLIP	23446348
MIRT521685	hsa-miR-7162-3p	PAR-CLIP	23446348
MIRT521684	hsa-miR-4786-5p	PAR-CLIP	23446348
MIRT521683	hsa-miR-769-5p	PAR-CLIP	23446348
MIRT521682	hsa-miR-655-5p	PAR-CLIP	23446348
MIRT521681	hsa-miR-377-5p	PAR-CLIP	23446348
MIRT521680	hsa-miR-6086	PAR-CLIP	23446348
MIRT521679	hsa-miR-92a-1-5p	PAR-CLIP	23446348
MIRT521678	hsa-miR-4425	PAR-CLIP	23446348
MIRT521677	hsa-miR-3672	PAR-CLIP	23446348
MIRT521676	hsa-miR-6864-3p	PAR-CLIP	23446348
MIRT521675	hsa-miR-30c-1-3p	PAR-CLIP	23446348
MIRT521674	hsa-miR-30c-2-3p	PAR-CLIP	23446348
MIRT521673	hsa-miR-6788-5p	PAR-CLIP	23446348
MIRT521671	hsa-miR-1273h-5p	PAR-CLIP	23446348
MIRT521672	hsa-miR-30b-3p	PAR-CLIP	23446348
MIRT521670	hsa-miR-3689a-3p	PAR-CLIP	23446348
MIRT521669	hsa-miR-3689b-3p	PAR-CLIP	23446348
MIRT521668	hsa-miR-3689c	PAR-CLIP	23446348
MIRT521667	hsa-miR-6779-5p	PAR-CLIP	23446348
MIRT521666	hsa-miR-6780a-5p	PAR-CLIP	23446348
MIRT521665	hsa-miR-887-5p	PAR-CLIP	23446348
MIRT485219	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT485218	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT031655	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT485217	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT485216	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT485214	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT485215	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT485212	hsa-miR-6758-5p	PAR-CLIP	23446348
MIRT485213	hsa-miR-6856-5p	PAR-CLIP	23446348
MIRT485211	hsa-miR-3125	PAR-CLIP	23446348
MIRT485210	hsa-miR-3916	PAR-CLIP	23446348
MIRT485209	hsa-miR-6859-5p	PAR-CLIP	23446348
MIRT485208	hsa-miR-451b	PAR-CLIP	23446348
MIRT485207	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT485206	hsa-miR-646	PAR-CLIP	23446348
MIRT485205	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT485204	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT485219	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT485218	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT031655	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT485217	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT485216	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT485214	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT485215	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT506033	hsa-miR-548e-5p	PAR-CLIP	23446348
MIRT485212	hsa-miR-6758-5p	PAR-CLIP	23446348
MIRT485213	hsa-miR-6856-5p	PAR-CLIP	23446348
MIRT485211	hsa-miR-3125	PAR-CLIP	23446348
MIRT485210	hsa-miR-3916	PAR-CLIP	23446348
MIRT485209	hsa-miR-6859-5p	PAR-CLIP	23446348
MIRT485208	hsa-miR-451b	PAR-CLIP	23446348
MIRT485207	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT485206	hsa-miR-646	PAR-CLIP	23446348
MIRT485205	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT485204	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT485219	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT485218	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT031655	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT485217	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT485216	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT485214	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT485215	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT506033	hsa-miR-548e-5p	PAR-CLIP	23446348
MIRT485212	hsa-miR-6758-5p	PAR-CLIP	23446348
MIRT485213	hsa-miR-6856-5p	PAR-CLIP	23446348
MIRT485211	hsa-miR-3125	PAR-CLIP	23446348
MIRT485210	hsa-miR-3916	PAR-CLIP	23446348
MIRT485209	hsa-miR-6859-5p	PAR-CLIP	23446348
MIRT485208	hsa-miR-451b	PAR-CLIP	23446348
MIRT485207	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT485206	hsa-miR-646	PAR-CLIP	23446348
MIRT485205	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT485204	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT485219	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT485218	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT031655	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT485217	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT485216	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT485214	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT485215	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT485212	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT485213	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT485211	hsa-miR-3125	PAR-CLIP	23592263
MIRT485210	hsa-miR-3916	PAR-CLIP	23592263
MIRT485209	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT485208	hsa-miR-451b	PAR-CLIP	23592263
MIRT485207	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT485206	hsa-miR-646	PAR-CLIP	23592263
MIRT485205	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT485204	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT1262780	hsa-miR-10a	CLIP-seq
MIRT1262781	hsa-miR-10b	CLIP-seq
MIRT1262782	hsa-miR-1184	CLIP-seq
MIRT1262783	hsa-miR-1205	CLIP-seq
MIRT1262784	hsa-miR-140-3p	CLIP-seq
MIRT1262785	hsa-miR-15a	CLIP-seq
MIRT1262786	hsa-miR-15b	CLIP-seq
MIRT1262787	hsa-miR-16	CLIP-seq
MIRT1262788	hsa-miR-195	CLIP-seq
MIRT1262789	hsa-miR-221	CLIP-seq
MIRT1262790	hsa-miR-222	CLIP-seq
MIRT1262791	hsa-miR-2861	CLIP-seq
MIRT1262792	hsa-miR-3120-3p	CLIP-seq
MIRT1262793	hsa-miR-3138	CLIP-seq
MIRT1262794	hsa-miR-3158-5p	CLIP-seq
MIRT1262795	hsa-miR-3166	CLIP-seq
MIRT1262796	hsa-miR-3198	CLIP-seq
MIRT1262797	hsa-miR-326	CLIP-seq
MIRT1262798	hsa-miR-330-5p	CLIP-seq
MIRT1262799	hsa-miR-3545-5p	CLIP-seq
MIRT1262800	hsa-miR-3653	CLIP-seq
MIRT1262801	hsa-miR-3908	CLIP-seq
MIRT1262802	hsa-miR-424	CLIP-seq
MIRT1262803	hsa-miR-4252	CLIP-seq
MIRT1262804	hsa-miR-4277	CLIP-seq
MIRT1262805	hsa-miR-4309	CLIP-seq
MIRT1262806	hsa-miR-4467	CLIP-seq
MIRT1262807	hsa-miR-4491	CLIP-seq
MIRT1262808	hsa-miR-4519	CLIP-seq
MIRT1262809	hsa-miR-4524	CLIP-seq
MIRT1262810	hsa-miR-4536	CLIP-seq
MIRT1262811	hsa-miR-4641	CLIP-seq
MIRT1262812	hsa-miR-4657	CLIP-seq
MIRT1262813	hsa-miR-4667-5p	CLIP-seq
MIRT1262814	hsa-miR-4700-5p	CLIP-seq
MIRT1262815	hsa-miR-4725-5p	CLIP-seq
MIRT1262816	hsa-miR-4771	CLIP-seq
MIRT1262817	hsa-miR-4790-3p	CLIP-seq
MIRT1262818	hsa-miR-4800-5p	CLIP-seq
MIRT1262819	hsa-miR-497	CLIP-seq
MIRT1262820	hsa-miR-503	CLIP-seq
MIRT1262821	hsa-miR-504	CLIP-seq
MIRT1262822	hsa-miR-520g	CLIP-seq
MIRT1262823	hsa-miR-520h	CLIP-seq
MIRT1262824	hsa-miR-544	CLIP-seq
MIRT1262825	hsa-miR-597	CLIP-seq
MIRT1262826	hsa-miR-601	CLIP-seq
MIRT1262827	hsa-miR-617	CLIP-seq
MIRT1262828	hsa-miR-637	CLIP-seq
MIRT1262829	hsa-miR-654-3p	CLIP-seq
MIRT1262830	hsa-miR-760	CLIP-seq
MIRT1262831	hsa-miR-873	CLIP-seq
MIRT1262832	hsa-miR-885-3p	CLIP-seq
MIRT2077375	hsa-miR-1270	CLIP-seq
MIRT1262785	hsa-miR-15a	CLIP-seq
MIRT1262786	hsa-miR-15b	CLIP-seq
MIRT1262787	hsa-miR-16	CLIP-seq
MIRT2077376	hsa-miR-185	CLIP-seq
MIRT1262788	hsa-miR-195	CLIP-seq
MIRT2077377	hsa-miR-2052	CLIP-seq
MIRT2077378	hsa-miR-214	CLIP-seq
MIRT1262789	hsa-miR-221	CLIP-seq
MIRT1262790	hsa-miR-222	CLIP-seq
MIRT2077379	hsa-miR-3619-5p	CLIP-seq
MIRT1262802	hsa-miR-424	CLIP-seq
MIRT1262803	hsa-miR-4252	CLIP-seq
MIRT2077380	hsa-miR-4269	CLIP-seq
MIRT2077381	hsa-miR-4291	CLIP-seq
MIRT2077382	hsa-miR-4306	CLIP-seq
MIRT2077383	hsa-miR-4514	CLIP-seq
MIRT1262809	hsa-miR-4524	CLIP-seq
MIRT2077384	hsa-miR-4531	CLIP-seq
MIRT2077385	hsa-miR-4644	CLIP-seq
MIRT2077386	hsa-miR-4692	CLIP-seq
MIRT2077387	hsa-miR-4742-5p	CLIP-seq
MIRT1262819	hsa-miR-497	CLIP-seq
MIRT1262820	hsa-miR-503	CLIP-seq
MIRT2077388	hsa-miR-548k	CLIP-seq
MIRT2077389	hsa-miR-620	CLIP-seq
MIRT2077390	hsa-miR-761	CLIP-seq
MIRT2077391	hsa-miR-922	CLIP-seq
MIRT1262785	hsa-miR-15a	CLIP-seq
MIRT1262786	hsa-miR-15b	CLIP-seq
MIRT1262787	hsa-miR-16	CLIP-seq
MIRT1262788	hsa-miR-195	CLIP-seq
MIRT1262802	hsa-miR-424	CLIP-seq
MIRT1262809	hsa-miR-4524	CLIP-seq
MIRT1262819	hsa-miR-497	CLIP-seq
MIRT1262820	hsa-miR-503	CLIP-seq
MIRT2392989	hsa-miR-1182	CLIP-seq
MIRT2392990	hsa-miR-1200	CLIP-seq
MIRT2077375	hsa-miR-1270	CLIP-seq
MIRT2077376	hsa-miR-185	CLIP-seq
MIRT2392991	hsa-miR-193a-5p	CLIP-seq
MIRT2077377	hsa-miR-2052	CLIP-seq
MIRT2392992	hsa-miR-3124-3p	CLIP-seq
MIRT2392993	hsa-miR-3163	CLIP-seq
MIRT2392994	hsa-miR-370	CLIP-seq
MIRT2077382	hsa-miR-4306	CLIP-seq
MIRT2392995	hsa-miR-4324	CLIP-seq
MIRT2392996	hsa-miR-4446-5p	CLIP-seq
MIRT2392997	hsa-miR-4468	CLIP-seq
MIRT2077384	hsa-miR-4531	CLIP-seq
MIRT2077385	hsa-miR-4644	CLIP-seq
MIRT2392998	hsa-miR-4731-5p	CLIP-seq
MIRT2392999	hsa-miR-4755-5p	CLIP-seq
MIRT2393000	hsa-miR-548ac	CLIP-seq
MIRT2393001	hsa-miR-548ae	CLIP-seq
MIRT2393002	hsa-miR-548aj	CLIP-seq
MIRT2393003	hsa-miR-548am	CLIP-seq
MIRT2393004	hsa-miR-548d-3p	CLIP-seq
MIRT2393005	hsa-miR-548x	CLIP-seq
MIRT2393006	hsa-miR-548z	CLIP-seq
MIRT2077389	hsa-miR-620	CLIP-seq
MIRT2393007	hsa-miR-628-5p	CLIP-seq
MIRT2432268	hsa-miR-297	CLIP-seq
MIRT2432269	hsa-miR-3686	CLIP-seq
MIRT1262801	hsa-miR-3908	CLIP-seq
MIRT1262804	hsa-miR-4277	CLIP-seq
MIRT1262806	hsa-miR-4467	CLIP-seq
MIRT1262808	hsa-miR-4519	CLIP-seq
MIRT2432270	hsa-miR-4652-3p	CLIP-seq
MIRT2432271	hsa-miR-4742-3p	CLIP-seq
MIRT2432272	hsa-miR-567	CLIP-seq
MIRT1262829	hsa-miR-654-3p	CLIP-seq
MIRT1262831	hsa-miR-873	CLIP-seq
MIRT1262832	hsa-miR-885-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004862	Function	CAMP-dependent protein kinase inhibitor activity	IBA
GO:0004862	Function	CAMP-dependent protein kinase inhibitor activity	IDA	21812984
GO:0004862	Function	CAMP-dependent protein kinase inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	9473338, 11278869, 11414803, 12475942, 16642035, 17911601, 20007971, 22343722, 22976297, 24083380, 24981860, 25920809, 26496610, 27484798, 32296183, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IDA	21423175
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	10799517
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	21423175
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10799517
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005930	Component	Axoneme	IDA	12475942
GO:0005952	Component	CAMP-dependent protein kinase complex	IBA
GO:0005952	Component	CAMP-dependent protein kinase complex	IDA	12475942
GO:0005952	Component	CAMP-dependent protein kinase complex	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0008603	Function	CAMP-dependent protein kinase regulator activity	IDA	21812984
GO:0008603	Function	CAMP-dependent protein kinase regulator activity	IEA
GO:0008603	Function	CAMP-dependent protein kinase regulator activity	NAS	9003463
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	10799517
GO:0019904	Function	Protein domain specific binding	IPI	25097019
GO:0030552	Function	CAMP binding	IBA
GO:0030552	Function	CAMP binding	IEA
GO:0031588	Component	Nucleotide-activated protein kinase complex	IDA	21812984
GO:0031625	Function	Ubiquitin protein ligase binding	IDA	21423175
GO:0032991	Component	Protein-containing complex	IDA	25097019
GO:0034236	Function	Protein kinase A catalytic subunit binding	IBA
GO:0034236	Function	Protein kinase A catalytic subunit binding	IEA
GO:0034236	Function	Protein kinase A catalytic subunit binding	IPI	17911601, 21812984
GO:0035556	Process	Intracellular signal transduction	TAS	2540040
GO:0044853	Component	Plasma membrane raft	IDA	17911601
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0097546	Component	Ciliary base	IEA
GO:0097546	Component	Ciliary base	TAS
GO:0141162	Process	Negative regulation of cAMP/PKA signal transduction	IDA	21812984
GO:0141162	Process	Negative regulation of cAMP/PKA signal transduction	IEA

Other IDs

• MIM: 176910
• HGNC: 9391
• e!Ensembl: ENSG00000114302

Protein

• UniProt ID: P13861
• Protein name: cAMP-dependent protein kinase type II-alpha regulatory subunit
• Protein function: Regulatory subunit of the cAMP-dependent protein kinases involved in cAMP signaling in cells. Type II regulatory chains mediate membrane association by binding to anchoring proteins, including the MAP2 kinase.
• PDB: 2IZX , 2KYG , 4ZP3 , 5H78 , 5XBY , 8S8O
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00027	cNMP_binding	279 → 373	Cyclic nucleotide-binding domain	Domain
  PF00027	cNMP_binding	157 → 244	Cyclic nucleotide-binding domain	Domain
  PF02197	RIIa	8 → 45	Regulatory subunit of type II PKA R-subunit	Domain

• Tissue specificity: TISSUE SPECIFICITY: Four types of regulatory chains are found: I-alpha, I-beta, II-alpha, and II-beta. Their expression varies among tissues and is in some cases constitutive and in others inducible.
• Sequence:

  MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLG
  HPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIH
  PKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIE
  RGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRI
  IVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYI
  IESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCL
  VMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ

• Sequence length: 404

Pathways

KEGG Pathway	Reactome Pathway
Insulin signaling pathway	PKA activation
	PKA activation in glucagon signalling
	DARPP-32 events
	Vasopressin regulates renal water homeostasis via Aquaporins
	CREB1 phosphorylation through the activation of Adenylate Cyclase
	Hedgehog 'off' state
	ADORA2B mediated anti-inflammatory cytokines production
	FCGR3A-mediated IL10 synthesis
	Factors involved in megakaryocyte development and platelet production

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
CONGESTIVE HEART FAILURE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	39406924	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROLITHIASIS	—	GWAS catalog	37787550	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (15)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adrenal cortical hypofunction	Adrenal Cortical Hypofunction	BEFREE	29846607		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia nervosa	Pubtator	39741260	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	19577713		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	25720397	Associate	★☆☆☆☆ Found in Text Mining only
Kallmann Syndrome	Kallmann Syndrome	BEFREE	16537498, 17191030, 29537336		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28121357		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25485509		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28121357		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	35295989	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28893231	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28121357		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	26440368, 29422542, 30632945		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25485509		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25485509	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	33878706	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PRKAR1A 10 shared pathwaysInsulin signaling pathway, Factors involved in megakaryocyte development and platelet production, DARPP-32 events, ADORA2B mediated anti-inflammatory cytokines production, Hedgehog 'off' state, Vasopressin regulates renal water homeostasis via Aquaporins, PKA activation, PKA activation in glucagon signalling, FCGR3A-mediated IL10 synthesis, CREB1 phosphorylation through the activation of Adenylate Cyclase Related via 10 shared pathways including Insulin signaling pathway, Factors involved in megakaryocyte development and platelet production. PRKAR1B 10 shared pathwaysInsulin signaling pathway, Factors involved in megakaryocyte development and platelet production, DARPP-32 events, ADORA2B mediated anti-inflammatory cytokines production, Hedgehog 'off' state, Vasopressin regulates renal water homeostasis via Aquaporins, PKA activation, PKA activation in glucagon signalling, FCGR3A-mediated IL10 synthesis, CREB1 phosphorylation through the activation of Adenylate Cyclase Related via 10 shared pathways including Insulin signaling pathway, Factors involved in megakaryocyte development and platelet production. PRKAR2B 1 shared diseaseCongestive heart failure 10 shared pathwaysInsulin signaling pathway, Factors involved in megakaryocyte development and platelet production, DARPP-32 events, ADORA2B mediated anti-inflammatory cytokines production, Hedgehog 'off' state, Vasopressin regulates renal water homeostasis via Aquaporins, PKA activation, PKA activation in glucagon signalling, FCGR3A-mediated IL10 synthesis, CREB1 phosphorylation through the activation of Adenylate Cyclase 2 shared evidence sourcesDisgenet (Congestive heart failure), Disgenet (Heart failure) Related via 10 shared pathways including Insulin signaling pathway, Factors involved in megakaryocyte development and platelet production — evidence mostly Disgenet. CHDH 1 shared diseaseCongestive heart failure 2 shared evidence sourcesDisgenet (Congestive heart failure), Disgenet (Heart failure) Related via 1 shared disease including Congestive heart failure — evidence mostly Disgenet. IFIT3 1 shared diseaseCongestive heart failure 2 shared evidence sourcesDisgenet (Congestive heart failure), Disgenet (Heart failure) Related via 1 shared disease including Congestive heart failure — evidence mostly Disgenet.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PRKAR1A	0	[]	10	["Insulin signaling pathway","Factors involved in megakaryocyte development and platelet production","DARPP-32 events","ADORA2B mediated anti-inflammatory cytokines production","Hedgehog 'off' state","Vasopressin regulates renal water homeostasis via Aquaporins","PKA activation","PKA activation in glucagon signalling","FCGR3A-mediated IL10 synthesis","CREB1 phosphorylation through the activation of Adenylate Cyclase"]	0	[]
PRKAR1B	0	[]	10	["Insulin signaling pathway","Factors involved in megakaryocyte development and platelet production","DARPP-32 events","ADORA2B mediated anti-inflammatory cytokines production","Hedgehog 'off' state","Vasopressin regulates renal water homeostasis via Aquaporins","PKA activation","PKA activation in glucagon signalling","FCGR3A-mediated IL10 synthesis","CREB1 phosphorylation through the activation of Adenylate Cyclase"]	0	[]
PRKAR2B	1	["Congestive heart failure"]	10	["Insulin signaling pathway","Factors involved in megakaryocyte development and platelet production","DARPP-32 events","ADORA2B mediated anti-inflammatory cytokines production","Hedgehog 'off' state","Vasopressin regulates renal water homeostasis via Aquaporins","PKA activation","PKA activation in glucagon signalling","FCGR3A-mediated IL10 synthesis","CREB1 phosphorylation through the activation of Adenylate Cyclase"]	2	["Disgenet (Congestive heart failure)","Disgenet (Heart failure)"]
CHDH	1	["Congestive heart failure"]	0	[]	2	["Disgenet (Congestive heart failure)","Disgenet (Heart failure)"]
IFIT3	1	["Congestive heart failure"]	0	[]	2	["Disgenet (Congestive heart failure)","Disgenet (Heart failure)"]

Diseases Linked via Similar Genes

Diabetes mellitus type 2 Linked via 2 of 5 related genesPRKAR1A, PRKAR2B Obesity Linked via 2 of 5 related genesPRKAR1A, PRKAR2B Acrodysostosis Linked via 1 of 5 related genesPRKAR1A Amelogenesis imperfecta Linked via 1 of 5 related genesPRKAR1A Arrhythmogenic right ventricular cardiomyopathy Linked via 1 of 5 related genesPRKAR1A

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Diabetes mellitus type 2	2	["PRKAR1A","PRKAR2B"]
Obesity	2	["PRKAR1A","PRKAR2B"]
Acrodysostosis	1	["PRKAR1A"]
Amelogenesis imperfecta	1	["PRKAR1A"]
Arrhythmogenic right ventricular cardiomyopathy	1	["PRKAR1A"]