Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	5558
Gene name	DNA primase subunit 2
Gene symbol	PRIM2
Synonyms (NCBI Gene)	PRIM2Ap58
Chromosome	6
Chromosome location	6p11.2
Summary	This gene encodes the 58 kilodalton subunit of DNA primase, an enzyme that plays a key role in the replication of DNA. The encoded protein forms a heterodimer with a 49 kilodalton subunit. This heterodimer functions as a DNA-directed RNA polymerase to syn

161 Show/Hide all (161)

miRTarBase ID	miRNA	Experiments	Reference
MIRT680537	hsa-miR-890	HITS-CLIP	23706177
MIRT680536	hsa-miR-4695-5p	HITS-CLIP	23706177
MIRT680535	hsa-miR-4779	HITS-CLIP	23706177
MIRT680534	hsa-miR-3929	HITS-CLIP	23706177
MIRT680533	hsa-miR-4419b	HITS-CLIP	23706177
MIRT680532	hsa-miR-4478	HITS-CLIP	23706177
MIRT680531	hsa-miR-3614-5p	HITS-CLIP	23706177
MIRT680530	hsa-miR-6500-3p	HITS-CLIP	23706177
MIRT680529	hsa-miR-7162-3p	HITS-CLIP	23706177
MIRT680528	hsa-miR-3160-3p	HITS-CLIP	23706177
MIRT680527	hsa-miR-558	HITS-CLIP	23706177
MIRT680526	hsa-miR-4487	HITS-CLIP	23706177
MIRT680525	hsa-miR-485-5p	HITS-CLIP	23706177
MIRT680524	hsa-miR-6884-5p	HITS-CLIP	23706177
MIRT680523	hsa-let-7a-5p	HITS-CLIP	23706177
MIRT680522	hsa-let-7b-5p	HITS-CLIP	23706177
MIRT680521	hsa-let-7c-5p	HITS-CLIP	23706177
MIRT680520	hsa-let-7d-5p	HITS-CLIP	23706177
MIRT680519	hsa-let-7e-5p	HITS-CLIP	23706177
MIRT680518	hsa-let-7f-5p	HITS-CLIP	23706177
MIRT680517	hsa-let-7g-5p	HITS-CLIP	23706177
MIRT680516	hsa-let-7i-5p	HITS-CLIP	23706177
MIRT680515	hsa-miR-4458	HITS-CLIP	23706177
MIRT680514	hsa-miR-4500	HITS-CLIP	23706177
MIRT680513	hsa-miR-98-5p	HITS-CLIP	23706177
MIRT680512	hsa-miR-202-3p	HITS-CLIP	23706177
MIRT680511	hsa-miR-7160-5p	HITS-CLIP	23706177
MIRT680510	hsa-miR-6894-5p	HITS-CLIP	23706177
MIRT680509	hsa-miR-7106-5p	HITS-CLIP	23706177
MIRT680508	hsa-miR-149-3p	HITS-CLIP	23706177
MIRT680507	hsa-miR-4728-5p	HITS-CLIP	23706177
MIRT680506	hsa-miR-6785-5p	HITS-CLIP	23706177
MIRT680505	hsa-miR-6883-5p	HITS-CLIP	23706177
MIRT680504	hsa-miR-6799-5p	HITS-CLIP	23706177
MIRT680503	hsa-miR-4266	HITS-CLIP	23706177
MIRT680502	hsa-miR-30c-1-3p	HITS-CLIP	23706177
MIRT680501	hsa-miR-30c-2-3p	HITS-CLIP	23706177
MIRT680500	hsa-miR-6788-5p	HITS-CLIP	23706177
MIRT680499	hsa-miR-1273h-5p	HITS-CLIP	23706177
MIRT680498	hsa-miR-30b-3p	HITS-CLIP	23706177
MIRT680497	hsa-miR-3689a-3p	HITS-CLIP	23706177
MIRT680496	hsa-miR-3689b-3p	HITS-CLIP	23706177
MIRT680495	hsa-miR-3689c	HITS-CLIP	23706177
MIRT680494	hsa-miR-6779-5p	HITS-CLIP	23706177
MIRT680493	hsa-miR-6780a-5p	HITS-CLIP	23706177
MIRT680492	hsa-miR-887-5p	HITS-CLIP	23706177
MIRT680491	hsa-miR-665	HITS-CLIP	23706177
MIRT680537	hsa-miR-890	HITS-CLIP	23706177
MIRT680536	hsa-miR-4695-5p	HITS-CLIP	23706177
MIRT680535	hsa-miR-4779	HITS-CLIP	23706177
MIRT680534	hsa-miR-3929	HITS-CLIP	23706177
MIRT680533	hsa-miR-4419b	HITS-CLIP	23706177
MIRT680532	hsa-miR-4478	HITS-CLIP	23706177
MIRT680531	hsa-miR-3614-5p	HITS-CLIP	23706177
MIRT680530	hsa-miR-6500-3p	HITS-CLIP	23706177
MIRT680529	hsa-miR-7162-3p	HITS-CLIP	23706177
MIRT680528	hsa-miR-3160-3p	HITS-CLIP	23706177
MIRT680527	hsa-miR-558	HITS-CLIP	23706177
MIRT680526	hsa-miR-4487	HITS-CLIP	23706177
MIRT680525	hsa-miR-485-5p	HITS-CLIP	23706177
MIRT680524	hsa-miR-6884-5p	HITS-CLIP	23706177
MIRT680523	hsa-let-7a-5p	HITS-CLIP	23706177
MIRT680522	hsa-let-7b-5p	HITS-CLIP	23706177
MIRT680521	hsa-let-7c-5p	HITS-CLIP	23706177
MIRT680520	hsa-let-7d-5p	HITS-CLIP	23706177
MIRT680519	hsa-let-7e-5p	HITS-CLIP	23706177
MIRT680518	hsa-let-7f-5p	HITS-CLIP	23706177
MIRT680517	hsa-let-7g-5p	HITS-CLIP	23706177
MIRT680516	hsa-let-7i-5p	HITS-CLIP	23706177
MIRT680515	hsa-miR-4458	HITS-CLIP	23706177
MIRT680514	hsa-miR-4500	HITS-CLIP	23706177
MIRT680513	hsa-miR-98-5p	HITS-CLIP	23706177
MIRT680512	hsa-miR-202-3p	HITS-CLIP	23706177
MIRT680511	hsa-miR-7160-5p	HITS-CLIP	23706177
MIRT680510	hsa-miR-6894-5p	HITS-CLIP	23706177
MIRT680509	hsa-miR-7106-5p	HITS-CLIP	23706177
MIRT680508	hsa-miR-149-3p	HITS-CLIP	23706177
MIRT680507	hsa-miR-4728-5p	HITS-CLIP	23706177
MIRT680506	hsa-miR-6785-5p	HITS-CLIP	23706177
MIRT680505	hsa-miR-6883-5p	HITS-CLIP	23706177
MIRT680504	hsa-miR-6799-5p	HITS-CLIP	23706177
MIRT680503	hsa-miR-4266	HITS-CLIP	23706177
MIRT680502	hsa-miR-30c-1-3p	HITS-CLIP	23706177
MIRT680501	hsa-miR-30c-2-3p	HITS-CLIP	23706177
MIRT680500	hsa-miR-6788-5p	HITS-CLIP	23706177
MIRT680499	hsa-miR-1273h-5p	HITS-CLIP	23706177
MIRT680498	hsa-miR-30b-3p	HITS-CLIP	23706177
MIRT680497	hsa-miR-3689a-3p	HITS-CLIP	23706177
MIRT680496	hsa-miR-3689b-3p	HITS-CLIP	23706177
MIRT680495	hsa-miR-3689c	HITS-CLIP	23706177
MIRT680494	hsa-miR-6779-5p	HITS-CLIP	23706177
MIRT680493	hsa-miR-6780a-5p	HITS-CLIP	23706177
MIRT680492	hsa-miR-887-5p	HITS-CLIP	23706177
MIRT680491	hsa-miR-665	HITS-CLIP	23706177
MIRT1261655	hsa-let-7a	CLIP-seq
MIRT1261656	hsa-let-7b	CLIP-seq
MIRT1261657	hsa-let-7c	CLIP-seq
MIRT1261658	hsa-let-7d	CLIP-seq
MIRT1261659	hsa-let-7e	CLIP-seq
MIRT1261660	hsa-let-7f	CLIP-seq
MIRT1261661	hsa-let-7g	CLIP-seq
MIRT1261662	hsa-let-7i	CLIP-seq
MIRT1261663	hsa-miR-1321	CLIP-seq
MIRT1261664	hsa-miR-202	CLIP-seq
MIRT1261665	hsa-miR-3162-5p	CLIP-seq
MIRT1261666	hsa-miR-4281	CLIP-seq
MIRT1261667	hsa-miR-4739	CLIP-seq
MIRT1261668	hsa-miR-4756-5p	CLIP-seq
MIRT1261669	hsa-miR-606	CLIP-seq
MIRT1261670	hsa-miR-98	CLIP-seq
MIRT1261655	hsa-let-7a	CLIP-seq
MIRT1261656	hsa-let-7b	CLIP-seq
MIRT1261657	hsa-let-7c	CLIP-seq
MIRT1261658	hsa-let-7d	CLIP-seq
MIRT1261659	hsa-let-7e	CLIP-seq
MIRT1261660	hsa-let-7f	CLIP-seq
MIRT1261661	hsa-let-7g	CLIP-seq
MIRT1261662	hsa-let-7i	CLIP-seq
MIRT1261664	hsa-miR-202	CLIP-seq
MIRT2077071	hsa-miR-3192	CLIP-seq
MIRT2077072	hsa-miR-326	CLIP-seq
MIRT2077073	hsa-miR-330-5p	CLIP-seq
MIRT1261666	hsa-miR-4281	CLIP-seq
MIRT2077074	hsa-miR-4314	CLIP-seq
MIRT2077075	hsa-miR-4646-5p	CLIP-seq
MIRT1261669	hsa-miR-606	CLIP-seq
MIRT1261670	hsa-miR-98	CLIP-seq
MIRT2303568	hsa-miR-1185	CLIP-seq
MIRT2303569	hsa-miR-1294	CLIP-seq
MIRT2077071	hsa-miR-3192	CLIP-seq
MIRT2077072	hsa-miR-326	CLIP-seq
MIRT2077073	hsa-miR-330-5p	CLIP-seq
MIRT2303570	hsa-miR-3605-5p	CLIP-seq
MIRT2303571	hsa-miR-3679-5p	CLIP-seq
MIRT2303572	hsa-miR-4261	CLIP-seq
MIRT2077074	hsa-miR-4314	CLIP-seq
MIRT2303573	hsa-miR-4316	CLIP-seq
MIRT2303574	hsa-miR-4438	CLIP-seq
MIRT2303575	hsa-miR-4496	CLIP-seq
MIRT2077075	hsa-miR-4646-5p	CLIP-seq
MIRT2303576	hsa-miR-548ac	CLIP-seq
MIRT2303577	hsa-miR-548ae	CLIP-seq
MIRT2303578	hsa-miR-548aj	CLIP-seq
MIRT2303579	hsa-miR-548am	CLIP-seq
MIRT2303580	hsa-miR-548d-3p	CLIP-seq
MIRT2303581	hsa-miR-548x	CLIP-seq
MIRT2303582	hsa-miR-548z	CLIP-seq
MIRT2392958	hsa-miR-24	CLIP-seq
MIRT2392959	hsa-miR-4284	CLIP-seq
MIRT2077071	hsa-miR-3192	CLIP-seq
MIRT2077072	hsa-miR-326	CLIP-seq
MIRT2077073	hsa-miR-330-5p	CLIP-seq
MIRT2077074	hsa-miR-4314	CLIP-seq
MIRT2077075	hsa-miR-4646-5p	CLIP-seq
MIRT2303569	hsa-miR-1294	CLIP-seq
MIRT2077071	hsa-miR-3192	CLIP-seq
MIRT2077072	hsa-miR-326	CLIP-seq
MIRT2077073	hsa-miR-330-5p	CLIP-seq
MIRT2077074	hsa-miR-4314	CLIP-seq
MIRT2303573	hsa-miR-4316	CLIP-seq
MIRT2077075	hsa-miR-4646-5p	CLIP-seq

21 Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0003899	Function	DNA-directed RNA polymerase activity	IMP	25550159
GO:0005515	Function	Protein binding	IPI	20643958, 28514442, 32296183, 32814053, 33961781
GO:0005654	Component	Nucleoplasm	TAS
GO:0005658	Component	Alpha DNA polymerase:primase complex	IBA
GO:0005658	Component	Alpha DNA polymerase:primase complex	IDA	8026492, 26975377
GO:0005658	Component	Alpha DNA polymerase:primase complex	IEA
GO:0005658	Component	Alpha DNA polymerase:primase complex	IPI	26975377
GO:0006260	Process	DNA replication	IEA
GO:0006269	Process	DNA replication, synthesis of primer	IBA
GO:0006269	Process	DNA replication, synthesis of primer	IDA	8026492
GO:0006269	Process	DNA replication, synthesis of primer	IEA
GO:0006269	Process	DNA replication, synthesis of primer	ISS
GO:0006270	Process	DNA replication initiation	IBA
GO:0006270	Process	DNA replication initiation	IDA	26975377
GO:0006270	Process	DNA replication initiation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051536	Function	Iron-sulfur cluster binding	IEA
GO:0051539	Function	4 iron, 4 sulfur cluster binding	IDA	25550159, 26975377
GO:0051539	Function	4 iron, 4 sulfur cluster binding	IEA
GO:0071667	Function	DNA/RNA hybrid binding	IDA	26975377

MIM	HGNC	e!Ensembl
176636	9370	ENSG00000146143

P49643

Protein name

DNA primase large subunit (DNA primase 58 kDa subunit) (p58)

Protein function

Regulatory subunit of the DNA primase complex and component of the DNA polymerase alpha complex (also known as the alpha DNA polymerase-primase complex) which play an essential role in the initiation of DNA synthesis (PubMed:17893144, PubMed:255

PDB

3L9Q , 3Q36 , 4BPU , 4BPW , 4BPX , 4RR2 , 5DQO , 5EXR , 5F0Q , 5F0S , 5I7M , 6DHW , 7OPL , 7U5C , 8B9D , 8D0B , 8D0K , 8D96 , 8D9D , 8QJ7 , 8VY3 , 9C8V

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04104	DNA_primase_lrg	182 → 448	Eukaryotic and archaeal DNA primase, large subunit	Family

Sequence

MEFSGRKWRKLRLAGDQRNASYPHCLQFYLQPPSENISLIEFENLAIDRVKLLKSVENLG
VSYVKGTEQYQSKLESELRKLKFSYRENLEDEYEPRRRDHISHFILRLAYCQSEELRRWF
IQQEMDLLRFRFSILPKDKIQDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGF
ESIYKIPFADALDLFRGRKVYLEDGFAYVPLKDIVAIILNEFRAKLSKALALTARSLPAV
QSDERLQPLLNHLSHSYTGQDYSTQGNVGKISLDQIDLLSTKSFPPCMRQLHKALRENHH
LRHGGRMQYGLFLKGIGLTLEQALQFWKQEFIKGKMDPDKFDKGYSYNIRHSFGKEGKRT
DYTPFSCLKIILSNPPSQGDYHGCPFRHSDPELLKQKLQSYKISPGGISQILDLVKGTHY
QVACQKYFEMIHNVDDCGFSLNHPNQFFCESQRILNGGKDIKKEPIQPETPQPKPSVQKT
KDASSALASLNSSLEMDMEGLEDYFSEDS

Sequence length

509

Interactions

View interactions

KEGG Pathway	Reactome Pathway
DNA replication	Inhibition of replication initiation of damaged DNA by RB1/E2F1
	Polymerase switching on the C-strand of the telomere
	Telomere C-strand synthesis initiation
	DNA replication initiation
	Activation of the pre-replicative complex
	Polymerase switching
	Removal of the Flap Intermediate
	Processive synthesis on the lagging strand

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (6)
ALZHEIMER DISEASE	—	GWAS catalog	35589863	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	29212778, 30104761, 33020668, 35285134, 36474045	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	33532862, 38072966	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	GWAS catalog	30104761	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	28714469	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (7)
Breast Carcinoma	Breast Carcinoma	BEFREE	18559534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34573430	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	22158537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	38423596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	31248429	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18559534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	27421018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
POLA2	[]	9	["DNA replication","Telomere C-strand synthesis initiation","Activation of the pre-replicative complex","Polymerase switching on the C-strand of the telomere","Polymerase switching","Removal of the Flap Intermediate","Processive synthesis on the lagging strand","Inhibition of replication initiation of damaged DNA by RB1\/E2F1","DNA replication initiation"]	[]
PRIM1	[]	9	["DNA replication","Telomere C-strand synthesis initiation","Activation of the pre-replicative complex","Polymerase switching on the C-strand of the telomere","Polymerase switching","Removal of the Flap Intermediate","Processive synthesis on the lagging strand","Inhibition of replication initiation of damaged DNA by RB1\/E2F1","DNA replication initiation"]	[]
POLA1	[]	9	["DNA replication","Telomere C-strand synthesis initiation","Activation of the pre-replicative complex","Polymerase switching on the C-strand of the telomere","Polymerase switching","Removal of the Flap Intermediate","Processive synthesis on the lagging strand","Inhibition of replication initiation of damaged DNA by RB1\/E2F1","DNA replication initiation"]	[]
POLD3	[]	5	["DNA replication","Polymerase switching on the C-strand of the telomere","Polymerase switching","Removal of the Flap Intermediate","Processive synthesis on the lagging strand"]	[]
POLD1	[]	5	["DNA replication","Polymerase switching on the C-strand of the telomere","Polymerase switching","Removal of the Flap Intermediate","Processive synthesis on the lagging strand"]	[]

PRIM2 (DNA primase subunit 2)

Bookmark This Gene