Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	7001
Gene name	Peroxiredoxin 2
Gene symbol	PRDX2
Synonyms (NCBI Gene)	HEL-S-2aNKEF-BNKEFBPRPPRX2PRXIIPTX1TDPX1TPX1TSA
Chromosome	19
Chromosome location	19p13.13
Summary	This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein plays an antioxidant protective role in cells, and it may contribute to the antiviral activity of C

213 Show/Hide all (213)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023992	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT047661	hsa-miR-10a-5p	CLASH	23622248
MIRT046023	hsa-miR-125b-5p	CLASH	23622248
MIRT042800	hsa-miR-339-5p	CLASH	23622248
MIRT039753	hsa-miR-615-3p	CLASH	23622248
MIRT1260410	hsa-miR-1228	CLIP-seq
MIRT1260411	hsa-miR-1245b-5p	CLIP-seq
MIRT1260412	hsa-miR-1253	CLIP-seq
MIRT1260413	hsa-miR-1275	CLIP-seq
MIRT1260414	hsa-miR-1293	CLIP-seq
MIRT1260415	hsa-miR-129-3p	CLIP-seq
MIRT1260416	hsa-miR-147b	CLIP-seq
MIRT1260417	hsa-miR-200b	CLIP-seq
MIRT1260418	hsa-miR-200c	CLIP-seq
MIRT1260419	hsa-miR-2682	CLIP-seq
MIRT1260420	hsa-miR-3138	CLIP-seq
MIRT1260421	hsa-miR-3142	CLIP-seq
MIRT1260422	hsa-miR-3176	CLIP-seq
MIRT1260423	hsa-miR-3184	CLIP-seq
MIRT1260424	hsa-miR-3612	CLIP-seq
MIRT1260425	hsa-miR-3922-3p	CLIP-seq
MIRT1260426	hsa-miR-409-5p	CLIP-seq
MIRT1260427	hsa-miR-423-5p	CLIP-seq
MIRT1260428	hsa-miR-4269	CLIP-seq
MIRT1260429	hsa-miR-429	CLIP-seq
MIRT1260430	hsa-miR-4290	CLIP-seq
MIRT1260431	hsa-miR-4310	CLIP-seq
MIRT1260432	hsa-miR-4318	CLIP-seq
MIRT1260433	hsa-miR-4417	CLIP-seq
MIRT1260434	hsa-miR-4436b-3p	CLIP-seq
MIRT1260435	hsa-miR-4443	CLIP-seq
MIRT1260436	hsa-miR-4446-5p	CLIP-seq
MIRT1260437	hsa-miR-4447	CLIP-seq
MIRT1260438	hsa-miR-4472	CLIP-seq
MIRT1260439	hsa-miR-4483	CLIP-seq
MIRT1260440	hsa-miR-4488	CLIP-seq
MIRT1260441	hsa-miR-4493	CLIP-seq
MIRT1260442	hsa-miR-449c	CLIP-seq
MIRT1260443	hsa-miR-4505	CLIP-seq
MIRT1260444	hsa-miR-4525	CLIP-seq
MIRT1260445	hsa-miR-4653-3p	CLIP-seq
MIRT1260446	hsa-miR-4665-5p	CLIP-seq
MIRT1260447	hsa-miR-4685-5p	CLIP-seq
MIRT1260448	hsa-miR-4687-5p	CLIP-seq
MIRT1260449	hsa-miR-4688	CLIP-seq
MIRT1260450	hsa-miR-4693-5p	CLIP-seq
MIRT1260451	hsa-miR-4697-5p	CLIP-seq
MIRT1260452	hsa-miR-4723-5p	CLIP-seq
MIRT1260453	hsa-miR-4726-3p	CLIP-seq
MIRT1260454	hsa-miR-4728-5p	CLIP-seq
MIRT1260455	hsa-miR-4736	CLIP-seq
MIRT1260456	hsa-miR-4755-5p	CLIP-seq
MIRT1260457	hsa-miR-4761-3p	CLIP-seq
MIRT1260458	hsa-miR-4777-3p	CLIP-seq
MIRT1260459	hsa-miR-486-3p	CLIP-seq
MIRT1260460	hsa-miR-541	CLIP-seq
MIRT1260461	hsa-miR-552	CLIP-seq
MIRT1260462	hsa-miR-625	CLIP-seq
MIRT1260463	hsa-miR-645	CLIP-seq
MIRT1260464	hsa-miR-650	CLIP-seq
MIRT1260465	hsa-miR-654-5p	CLIP-seq
MIRT1260466	hsa-miR-892a	CLIP-seq
MIRT1260467	hsa-miR-940	CLIP-seq
MIRT1260411	hsa-miR-1245b-5p	CLIP-seq
MIRT1260412	hsa-miR-1253	CLIP-seq
MIRT1260413	hsa-miR-1275	CLIP-seq
MIRT1260414	hsa-miR-1293	CLIP-seq
MIRT1260415	hsa-miR-129-3p	CLIP-seq
MIRT1260416	hsa-miR-147b	CLIP-seq
MIRT1260421	hsa-miR-3142	CLIP-seq
MIRT1260424	hsa-miR-3612	CLIP-seq
MIRT1260426	hsa-miR-409-5p	CLIP-seq
MIRT1260430	hsa-miR-4290	CLIP-seq
MIRT1260432	hsa-miR-4318	CLIP-seq
MIRT1260433	hsa-miR-4417	CLIP-seq
MIRT1260435	hsa-miR-4443	CLIP-seq
MIRT1260437	hsa-miR-4447	CLIP-seq
MIRT1260438	hsa-miR-4472	CLIP-seq
MIRT1260439	hsa-miR-4483	CLIP-seq
MIRT1260440	hsa-miR-4488	CLIP-seq
MIRT1260441	hsa-miR-4493	CLIP-seq
MIRT1260443	hsa-miR-4505	CLIP-seq
MIRT1260444	hsa-miR-4525	CLIP-seq
MIRT1260445	hsa-miR-4653-3p	CLIP-seq
MIRT1260446	hsa-miR-4665-5p	CLIP-seq
MIRT1260447	hsa-miR-4685-5p	CLIP-seq
MIRT1260448	hsa-miR-4687-5p	CLIP-seq
MIRT1260450	hsa-miR-4693-5p	CLIP-seq
MIRT1260451	hsa-miR-4697-5p	CLIP-seq
MIRT1260452	hsa-miR-4723-5p	CLIP-seq
MIRT1260453	hsa-miR-4726-3p	CLIP-seq
MIRT1260454	hsa-miR-4728-5p	CLIP-seq
MIRT1260458	hsa-miR-4777-3p	CLIP-seq
MIRT1260460	hsa-miR-541	CLIP-seq
MIRT1260461	hsa-miR-552	CLIP-seq
MIRT1260462	hsa-miR-625	CLIP-seq
MIRT1260463	hsa-miR-645	CLIP-seq
MIRT1260464	hsa-miR-650	CLIP-seq
MIRT1260465	hsa-miR-654-5p	CLIP-seq
MIRT1260466	hsa-miR-892a	CLIP-seq
MIRT2303376	hsa-miR-1207-5p	CLIP-seq
MIRT1260411	hsa-miR-1245b-5p	CLIP-seq
MIRT1260412	hsa-miR-1253	CLIP-seq
MIRT1260413	hsa-miR-1275	CLIP-seq
MIRT1260414	hsa-miR-1293	CLIP-seq
MIRT1260415	hsa-miR-129-3p	CLIP-seq
MIRT2303377	hsa-miR-1343	CLIP-seq
MIRT1260416	hsa-miR-147b	CLIP-seq
MIRT2303378	hsa-miR-1909	CLIP-seq
MIRT1260419	hsa-miR-2682	CLIP-seq
MIRT2303379	hsa-miR-3074-5p	CLIP-seq
MIRT2303380	hsa-miR-3124-3p	CLIP-seq
MIRT1260420	hsa-miR-3138	CLIP-seq
MIRT1260421	hsa-miR-3142	CLIP-seq
MIRT1260422	hsa-miR-3176	CLIP-seq
MIRT1260423	hsa-miR-3184	CLIP-seq
MIRT1260424	hsa-miR-3612	CLIP-seq
MIRT1260425	hsa-miR-3922-3p	CLIP-seq
MIRT1260426	hsa-miR-409-5p	CLIP-seq
MIRT1260427	hsa-miR-423-5p	CLIP-seq
MIRT1260428	hsa-miR-4269	CLIP-seq
MIRT1260430	hsa-miR-4290	CLIP-seq
MIRT1260431	hsa-miR-4310	CLIP-seq
MIRT1260432	hsa-miR-4318	CLIP-seq
MIRT1260433	hsa-miR-4417	CLIP-seq
MIRT1260434	hsa-miR-4436b-3p	CLIP-seq
MIRT1260435	hsa-miR-4443	CLIP-seq
MIRT1260437	hsa-miR-4447	CLIP-seq
MIRT1260438	hsa-miR-4472	CLIP-seq
MIRT1260439	hsa-miR-4483	CLIP-seq
MIRT1260440	hsa-miR-4488	CLIP-seq
MIRT1260441	hsa-miR-4493	CLIP-seq
MIRT1260442	hsa-miR-449c	CLIP-seq
MIRT1260443	hsa-miR-4505	CLIP-seq
MIRT1260444	hsa-miR-4525	CLIP-seq
MIRT1260445	hsa-miR-4653-3p	CLIP-seq
MIRT2303381	hsa-miR-4662a-5p	CLIP-seq
MIRT1260446	hsa-miR-4665-5p	CLIP-seq
MIRT2303382	hsa-miR-4676-5p	CLIP-seq
MIRT1260447	hsa-miR-4685-5p	CLIP-seq
MIRT1260448	hsa-miR-4687-5p	CLIP-seq
MIRT1260449	hsa-miR-4688	CLIP-seq
MIRT1260450	hsa-miR-4693-5p	CLIP-seq
MIRT1260451	hsa-miR-4697-5p	CLIP-seq
MIRT1260452	hsa-miR-4723-5p	CLIP-seq
MIRT1260453	hsa-miR-4726-3p	CLIP-seq
MIRT1260454	hsa-miR-4728-5p	CLIP-seq
MIRT1260455	hsa-miR-4736	CLIP-seq
MIRT1260457	hsa-miR-4761-3p	CLIP-seq
MIRT2303383	hsa-miR-4763-3p	CLIP-seq
MIRT1260458	hsa-miR-4777-3p	CLIP-seq
MIRT2303384	hsa-miR-4800-3p	CLIP-seq
MIRT1260459	hsa-miR-486-3p	CLIP-seq
MIRT1260460	hsa-miR-541	CLIP-seq
MIRT1260461	hsa-miR-552	CLIP-seq
MIRT2303385	hsa-miR-575	CLIP-seq
MIRT1260462	hsa-miR-625	CLIP-seq
MIRT1260463	hsa-miR-645	CLIP-seq
MIRT1260464	hsa-miR-650	CLIP-seq
MIRT1260465	hsa-miR-654-5p	CLIP-seq
MIRT1260466	hsa-miR-892a	CLIP-seq
MIRT1260467	hsa-miR-940	CLIP-seq
MIRT1260416	hsa-miR-147b	CLIP-seq
MIRT1260445	hsa-miR-4653-3p	CLIP-seq
MIRT1260411	hsa-miR-1245b-5p	CLIP-seq
MIRT1260412	hsa-miR-1253	CLIP-seq
MIRT1260413	hsa-miR-1275	CLIP-seq
MIRT1260414	hsa-miR-1293	CLIP-seq
MIRT1260415	hsa-miR-129-3p	CLIP-seq
MIRT2303377	hsa-miR-1343	CLIP-seq
MIRT1260416	hsa-miR-147b	CLIP-seq
MIRT1260417	hsa-miR-200b	CLIP-seq
MIRT1260418	hsa-miR-200c	CLIP-seq
MIRT2303379	hsa-miR-3074-5p	CLIP-seq
MIRT2303380	hsa-miR-3124-3p	CLIP-seq
MIRT1260421	hsa-miR-3142	CLIP-seq
MIRT1260422	hsa-miR-3176	CLIP-seq
MIRT1260423	hsa-miR-3184	CLIP-seq
MIRT1260424	hsa-miR-3612	CLIP-seq
MIRT1260425	hsa-miR-3922-3p	CLIP-seq
MIRT1260426	hsa-miR-409-5p	CLIP-seq
MIRT1260427	hsa-miR-423-5p	CLIP-seq
MIRT1260429	hsa-miR-429	CLIP-seq
MIRT1260430	hsa-miR-4290	CLIP-seq
MIRT1260431	hsa-miR-4310	CLIP-seq
MIRT1260432	hsa-miR-4318	CLIP-seq
MIRT1260433	hsa-miR-4417	CLIP-seq
MIRT1260434	hsa-miR-4436b-3p	CLIP-seq
MIRT1260435	hsa-miR-4443	CLIP-seq
MIRT1260436	hsa-miR-4446-5p	CLIP-seq
MIRT1260439	hsa-miR-4483	CLIP-seq
MIRT1260441	hsa-miR-4493	CLIP-seq
MIRT1260443	hsa-miR-4505	CLIP-seq
MIRT1260444	hsa-miR-4525	CLIP-seq
MIRT1260445	hsa-miR-4653-3p	CLIP-seq
MIRT1260446	hsa-miR-4665-5p	CLIP-seq
MIRT1260447	hsa-miR-4685-5p	CLIP-seq
MIRT1260448	hsa-miR-4687-5p	CLIP-seq
MIRT1260449	hsa-miR-4688	CLIP-seq
MIRT1260450	hsa-miR-4693-5p	CLIP-seq
MIRT1260452	hsa-miR-4723-5p	CLIP-seq
MIRT1260454	hsa-miR-4728-5p	CLIP-seq
MIRT1260455	hsa-miR-4736	CLIP-seq
MIRT1260456	hsa-miR-4755-5p	CLIP-seq
MIRT1260457	hsa-miR-4761-3p	CLIP-seq
MIRT1260458	hsa-miR-4777-3p	CLIP-seq
MIRT1260459	hsa-miR-486-3p	CLIP-seq
MIRT1260460	hsa-miR-541	CLIP-seq
MIRT1260462	hsa-miR-625	CLIP-seq
MIRT1260463	hsa-miR-645	CLIP-seq
MIRT1260464	hsa-miR-650	CLIP-seq
MIRT1260465	hsa-miR-654-5p	CLIP-seq
MIRT1260466	hsa-miR-892a	CLIP-seq

45 Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002357	Process	Defense response to tumor cell	IMP	30429596
GO:0002536	Process	Respiratory burst involved in inflammatory response	IEA
GO:0004601	Function	Peroxidase activity	IEA
GO:0005515	Function	Protein binding	IPI	17557078, 25402766
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0006979	Process	Response to oxidative stress	IBA
GO:0006979	Process	Response to oxidative stress	IMP	12943237
GO:0006979	Process	Response to oxidative stress	NAS	11904290
GO:0008379	Function	Thioredoxin peroxidase activity	IBA
GO:0008379	Function	Thioredoxin peroxidase activity	IDA	8144038
GO:0008379	Function	Thioredoxin peroxidase activity	TAS	18606987
GO:0010310	Process	Regulation of hydrogen peroxide metabolic process	IEA
GO:0016209	Function	Antioxidant activity	IDA	8144038
GO:0016209	Function	Antioxidant activity	IEA
GO:0016209	Function	Antioxidant activity	NAS	12943237
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0019430	Process	Removal of superoxide radicals	IBA
GO:0019430	Process	Removal of superoxide radicals	IDA	20978343
GO:0019430	Process	Removal of superoxide radicals	IEA
GO:0030194	Process	Positive regulation of blood coagulation	IEA
GO:0031665	Process	Negative regulation of lipopolysaccharide-mediated signaling pathway	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0034599	Process	Cellular response to oxidative stress	IDA	20978343
GO:0042098	Process	T cell proliferation	IEA
GO:0042743	Process	Hydrogen peroxide metabolic process	IEA
GO:0042744	Process	Hydrogen peroxide catabolic process	IBA
GO:0042744	Process	Hydrogen peroxide catabolic process	IEA
GO:0042744	Process	Hydrogen peroxide catabolic process	TAS	18606987
GO:0042981	Process	Regulation of apoptotic process	IMP	12943237
GO:0043029	Process	T cell homeostasis	IEA
GO:0043066	Process	Negative regulation of apoptotic process	TAS	16130169
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0045321	Process	Leukocyte activation	IBA
GO:0045454	Process	Cell redox homeostasis	IBA
GO:0045581	Process	Negative regulation of T cell differentiation	IEA
GO:0048538	Process	Thymus development	IEA
GO:0051920	Function	Peroxiredoxin activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708, 20458337, 23533145
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:0140824	Function	Thioredoxin-dependent peroxiredoxin activity	IEA
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IEA
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA

MIM	HGNC	e!Ensembl
600538	9353	ENSG00000167815

P32119

Protein name

Peroxiredoxin-2 (EC 1.11.1.24) (Natural killer cell-enhancing factor B) (NKEF-B) (PRP) (Thiol-specific antioxidant protein) (TSA) (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thioredoxin-dependent peroxiredoxin 2)

Protein function

Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrog

PDB

1QMV , 5B8A , 5B8B , 5IJT , 7KIZ , 7KJ0 , 7KJ1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00578	AhpC-TSA	8 → 141	AhpC/TSA family	Domain
PF10417	1-cysPrx_C	161 → 196	C-terminal domain of 1-Cys peroxiredoxin	Domain

Sequence

MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSN
RAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKT
DEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGS
DTIKPNVDDSKEYFSKHN

Sequence length

198

Interactions

View interactions

Reactome Pathway
Detoxification of Reactive Oxygen Species
TP53 Regulates Metabolic Genes

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (9)
ASBESTOSIS	—	CTD, Disgenet CTD, Disgenet	22537621	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	16316942	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	21472284	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DOWN SYNDROME	—	CTD, Disgenet CTD, Disgenet	11771762	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	15986332	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID	—	CTD	16932348	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	16778180	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOSARCOMA	—	CTD	23911960	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	17566973	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (200)
Acoustic Neuroma	Acoustic Neuroma	BEFREE	31146115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	21750082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	22207736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15034014, 31197039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11048804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	28683851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	29443105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	BEFREE	29443105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18752637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	31194501		★★★★★ ★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	14648077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	14648077, 16598672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	30395970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	BEFREE	29443105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	30521599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	19951064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	BEFREE	17990289, 22960070, 30521599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	31279092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	24976601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16778393, 22565169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	CTD_human_DG	22537621		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthenozoospermia	Asthenozoospermia	BEFREE	26585682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	20307276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	31578139	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31578139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bernard-Soulier Syndrome	Bernard Soulier Syndrome	BEFREE	14717981, 4031633, 759524		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	21750082, 30521599, 40085946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	30521599		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	30521599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	15936593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17998816, 19584157, 21494810, 22430214, 23048078, 26970563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20005186, 29545070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	30115731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	LHGDN	18022079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28261610, 34915198	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29332450, 33771165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30747220	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	15936593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26021759, 26101014, 28652781, 30988280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29070896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	29438398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	19332114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30655626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19367286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	33017884, 34320944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	23852020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma Middle Ear	Middle ear cholesteatoma	Pubtator	23852020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	18612811, 24178909, 26094604, 29138803, 31180539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Hemolysis	Hemolysis	BEFREE	28793778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	21975116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	21975116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21858218, 27894099, 28432271, 31388312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24125860, 24234423, 24920174, 25471788, 27894099, 28003121, 28125800, 29258530, 30679085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28125800, 29258530	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30872677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Creutzfeldt-Jakob Disease, Familial	Creutzfeldt-Jakob disease	BEFREE	1357594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Creutzfeldt-Jakob Disease, Sporadic	Creutzfeldt-Jakob disease	BEFREE	10762506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	27052304, 28339078, 29379374, 30443214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	31089363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21975116, 24343817	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30319545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	37758743	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	30132841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	11771746, 12650976, 12943237		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Down Syndrome	Down Syndrome	CTD_human_DG	11771762		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Down Syndrome	Down Syndrome	BEFREE	12650976, 12943237		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Down Syndrome	Down syndrome	Pubtator	12943237	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Down Syndrome, Partial Trisomy 21	Down Syndrome	CTD_human_DG	11771762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	7767489, 8137132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	29070896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28392898, 29524086, 31804468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	15986332		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28392898, 29524086, 31804468		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fabry Disease	Fabry disease	BEFREE	25619383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	25619383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatal Familial Insomnia	Fatal Insomnia	BEFREE	20806222, 9270595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gerstmann-Straussler-Scheinker Disease	Gerstmann-Straussler-Scheinker syndrome	BEFREE	10581259, 1684745, 29338055, 31142381, 7858176, 7922109, 9153600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	30295074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26094604, 31531023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	37566013	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	39684695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26094604, 31531023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	18718523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	25619383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	12963914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	24862795	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	31639263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia, NOS	Hemophilia	BEFREE	31639263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary spherocytosis	Hereditary Spherocytosis	LHGDN	18387321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	31385466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28801243, 31619708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28801243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	27869326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	28464953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	28793778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	29379374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29476062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	30245403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	22207736	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Monocytic, Chronic	Monocytic Leukemia	CTD_human_DG	16932348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	22207736, 29720484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	30605715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12494463, 23643933, 26239364, 26500057, 29437631, 30611866, 30747220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	21472284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	20939925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	12494463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	33440265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30988280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28125800	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	26636537	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17998816, 19584157, 22430214, 26970563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	15986332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28392898, 29524086, 31804468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	12494463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26021759, 26101014, 28652781, 30988280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29130098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11445006, 12932305, 16989575, 21539911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17566973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30214590, 30254439, 30879771, 31536951, 31807984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	15936593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12963914, 18612811, 21148313, 25990457, 26021759, 27894099, 28261610, 29130098, 29435053, 30087344, 30177619, 30611866, 30747220, 31180539, 31185618, 31567534 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21858218, 27894099, 28432271, 31388312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19584157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mandibulofacial Dysostosis	Mandibulofacial Dysostosis	BEFREE	9337397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	27614429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	11277417		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16034300, 16778180		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	16778180		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	31180579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	22335413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	32973234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28375164		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	24862795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	CTD_human_DG	16932348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28184180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15936593, 18413821, 18514066, 21148313, 21491416, 21494810, 22064513, 22207736, 24178909, 25471788, 26094604, 26130461, 26500057, 27894099, 28125800 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12943237, 20811720, 21123453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28871473		★★★★★ ★☆☆☆☆ Found in Text Mining only
New Variant Creutzfeldt-Jakob Disease	Creutzfeldt-Jakob Disease	BEFREE	10931212, 16480953, 21790605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18413821, 30341415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	32329817	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	29388085, 29511819, 31538913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29180271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	23911960		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	CTD_human_DG	23911960		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Failure, Premature	Ovarian Failure	BEFREE	29778464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23965899, 31315664	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29130098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36712921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	18003920, 21209210, 28823893, 29054681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	18003920		★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	21209210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	21975116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	21975116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	12650976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	LHGDN	12650976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	29778464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	20858855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11445006, 12932305, 16989575, 21539911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	12932305		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17566973		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21031435	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pterygium	Pterygium	BEFREE	23499777, 25221425, 28489720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27583477, 30872677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	22565169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rotator cuff syndrome	Rotator cuff syndrome	BEFREE	27684960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	39234629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	19165527		★★★★★ ★☆☆☆☆ Found in Text Mining only
SEBASTIAN SYNDROME	SEBASTIAN SYNDROME	BEFREE	4031633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30782124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	30935825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	21805023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	27864139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	23440187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	31470801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30657231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18339795	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24343817, 33332365	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	21092172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29782848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30214590, 30254439, 30879771, 31536951, 31807984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29422545, 32382548, 35831348	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29554978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	31847701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	29300106, 30487054, 31840415, 31842921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	16788983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31559416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trisomy 21, Meiotic Nondisjunction	Trisomy 21	CTD_human_DG	11771762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trisomy 21, Mitotic Nondisjunction	Trisomy 21	CTD_human_DG	11771762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24083701	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	21119665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19367286, 28261610, 31470801, 34915198	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vaginal Neoplasms	Vaginal neoplasms	Pubtator	19367286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	28801243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	31541597		★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	31541597		★★★★★ ★☆☆☆☆ Found in Text Mining only

PRDX2 (peroxiredoxin 2)

Save This Analysis