Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	51367
Gene name	POP5 ribonuclease P/MRP subunit
Gene symbol	POP5
Synonyms (NCBI Gene)	HSPC004RPP2RPP20hPop5
Chromosome	12
Chromosome location	12q24.31

21 Show/Hide all (21)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022544	hsa-miR-124-3p	Proteomics	18668037
MIRT2073888	hsa-miR-1226	CLIP-seq
MIRT2073889	hsa-miR-139-5p	CLIP-seq
MIRT2073890	hsa-miR-197	CLIP-seq
MIRT2073891	hsa-miR-3146	CLIP-seq
MIRT2073892	hsa-miR-3618	CLIP-seq
MIRT2073893	hsa-miR-3942-5p	CLIP-seq
MIRT2073894	hsa-miR-412	CLIP-seq
MIRT2073895	hsa-miR-4703-5p	CLIP-seq
MIRT2073896	hsa-miR-4733-3p	CLIP-seq
MIRT2073897	hsa-miR-4772-3p	CLIP-seq
MIRT2073898	hsa-miR-4797-5p	CLIP-seq
MIRT2073899	hsa-miR-513b	CLIP-seq
MIRT2073900	hsa-miR-934	CLIP-seq
MIRT2300725	hsa-miR-4280	CLIP-seq
MIRT2300726	hsa-miR-4293	CLIP-seq
MIRT2300727	hsa-miR-4468	CLIP-seq
MIRT2300728	hsa-miR-4519	CLIP-seq
MIRT2300729	hsa-miR-4676-5p	CLIP-seq
MIRT2300730	hsa-miR-4786-3p	CLIP-seq
MIRT2300731	hsa-miR-575	CLIP-seq

25 Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000172	Component	Ribonuclease MRP complex	IBA
GO:0000172	Component	Ribonuclease MRP complex	IDA	16723659
GO:0001682	Process	TRNA 5'-leader removal	IBA
GO:0001682	Process	TRNA 5'-leader removal	IDA	16723659, 30454648
GO:0001682	Process	TRNA 5'-leader removal	IEA
GO:0003723	Function	RNA binding	IEA
GO:0004526	Function	Ribonuclease P activity	IDA	30454648
GO:0004526	Function	Ribonuclease P activity	IEA
GO:0005515	Function	Protein binding	IPI	15096576, 22458338, 25416956, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005655	Component	Nucleolar ribonuclease P complex	IEA
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA	11413139
GO:0005730	Component	Nucleolus	IEA
GO:0006364	Process	RRNA processing	IEA
GO:0008033	Process	TRNA processing	IEA
GO:0008033	Process	TRNA processing	IEA
GO:0030677	Component	Ribonuclease P complex	IEA
GO:0030681	Component	Multimeric ribonuclease P complex	IBA
GO:0030681	Component	Multimeric ribonuclease P complex	IDA	16723659, 30454648
GO:0030681	Component	Multimeric ribonuclease P complex	IEA
GO:0033204	Function	Ribonuclease P RNA binding	IBA
GO:0033204	Function	Ribonuclease P RNA binding	IDA	16723659, 30454648
GO:0033204	Function	Ribonuclease P RNA binding	IEA

MIM	HGNC	e!Ensembl
609992	17689	ENSG00000167272

Q969H6

Protein name

Ribonuclease P/MRP protein subunit POP5 (hPop5)

Protein function

Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends (PubMed:11413139, PubMed:30454648). Also a component of the MRP ribonuclease complex, which cleaves pre-rRNA sequences (PubMed:28115465

PDB

6AHR , 6AHU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01900	RNase_P_Rpp14	7 → 115	Rpp14/Pop5 family	Family

Sequence

MVRFKHRYLLCELVSDDPRCRLSLDDRVLSSLVRDTIARVHGTFGAAACSIGFAVRYLNA
YTGIVLLRCRKEFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRR
QLLILLQNCTDEGEREAIQKSVTRSCLLEEEEESGEEAAEAME

Sequence length

163

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Ribosome biogenesis in eukaryotes	tRNA processing in the nucleus

POP5 (POP5 ribonuclease P/MRP subunit)

Bookmark This Gene