Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	285877
Gene name	POM121 transmembrane nucleoporin like 12
Gene symbol	POM121L12
Synonyms (NCBI Gene)	-
Chromosome	7
Chromosome location	7p12.1

16 Show/Hide all (16)

miRTarBase ID	miRNA	Experiments
MIRT1250035	hsa-miR-1255a	CLIP-seq
MIRT1250036	hsa-miR-1255b	CLIP-seq
MIRT1250037	hsa-miR-3125	CLIP-seq
MIRT1250038	hsa-miR-3154	CLIP-seq
MIRT1250039	hsa-miR-3185	CLIP-seq
MIRT1250040	hsa-miR-3192	CLIP-seq
MIRT1250041	hsa-miR-3202	CLIP-seq
MIRT1250042	hsa-miR-3916	CLIP-seq
MIRT1250043	hsa-miR-3942-3p	CLIP-seq
MIRT1250044	hsa-miR-4257	CLIP-seq
MIRT1250045	hsa-miR-4434	CLIP-seq
MIRT1250046	hsa-miR-4436b-3p	CLIP-seq
MIRT1250047	hsa-miR-4476	CLIP-seq
MIRT1250048	hsa-miR-4516	CLIP-seq
MIRT1250049	hsa-miR-4531	CLIP-seq
MIRT1250050	hsa-miR-4802-3p	CLIP-seq

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q8N7R1

Protein name

POM121-like protein 12

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15229	POM121	190 → 246		Family

Sequence

MGAAAPAESADLGNFWKAGEPLLQGPDALAAPMSRSPSTPQTTPSPQGRQSPWPLRSLTQ
SHIQYFQWGRPVPSTHLIEVRPTQDPAKPQRVVSEGWRRPALPGETALGRDLSCAWEGCM
KGGLCRAWNPGRTWSPVTIGIAPPERQESPWRSPGQRARPAGRPAAQELLDPCTRETLLG
ALSQCPKGSARFDGPLWFEVSDSKGGRRNLQPRPSAFKPLSKNGAVASFVPRPGPLKPSL
GPWSLSFCDDAWPSVLVQPAPSAIWDFWEATTPSCGSCSRVSFALEVTQSAGPFGS

Sequence length

296

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (6)
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	34446935	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GILLES DE LA TOURETTE SYNDROME	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	37040585	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	38757301	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	34446935	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Metabolic Syndrome	Metabolic syndrome	Pubtator	38291185	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

POM121L12 (POM121 transmembrane nucleoporin like 12)

Bookmark This Gene