PMVK (phosphomevalonate kinase)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 10654
• Gene name: Phosphomevalonate kinase
• Gene symbol: PMVK
• Synonyms (NCBI Gene): HUMPMKI, PMK, PMKA, PMKASE, POROK1
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: This gene encodes a peroxisomal enzyme that is a member of the galactokinase, homoserine kinase, mevalonate kinase, and phosphomevalonate kinase (GHMP) family of ATP-dependent enzymes. The encoded protein catalyzes the conversion of mevalonate 5-phosphate

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs745983207	G>A	Pathogenic	Stop gained, coding sequence variant

miRNA Show/Hide all (137)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1244673	hsa-miR-140-3p	CLIP-seq
MIRT1244674	hsa-miR-146a	CLIP-seq
MIRT1244675	hsa-miR-146b-5p	CLIP-seq
MIRT1244676	hsa-miR-2467-3p	CLIP-seq
MIRT1244677	hsa-miR-3140-5p	CLIP-seq
MIRT1244678	hsa-miR-3678-3p	CLIP-seq
MIRT1244679	hsa-miR-3922-5p	CLIP-seq
MIRT1244680	hsa-miR-4251	CLIP-seq
MIRT1244681	hsa-miR-4279	CLIP-seq
MIRT1244682	hsa-miR-4323	CLIP-seq
MIRT1244683	hsa-miR-450b-5p	CLIP-seq
MIRT1244684	hsa-miR-4656	CLIP-seq
MIRT1244685	hsa-miR-4687-3p	CLIP-seq
MIRT1244686	hsa-miR-4690-3p	CLIP-seq
MIRT1244687	hsa-miR-4708-3p	CLIP-seq
MIRT1244688	hsa-miR-4709-3p	CLIP-seq
MIRT1244689	hsa-miR-4717-5p	CLIP-seq
MIRT1244690	hsa-miR-4753-5p	CLIP-seq
MIRT1244691	hsa-miR-4758-3p	CLIP-seq
MIRT1244692	hsa-miR-507	CLIP-seq
MIRT1244693	hsa-miR-557	CLIP-seq
MIRT1244694	hsa-miR-589	CLIP-seq
MIRT1244695	hsa-miR-626	CLIP-seq
MIRT2072363	hsa-miR-1207-5p	CLIP-seq
MIRT2072364	hsa-miR-1224-3p	CLIP-seq
MIRT2072365	hsa-miR-183	CLIP-seq
MIRT2072366	hsa-miR-214	CLIP-seq
MIRT1244676	hsa-miR-2467-3p	CLIP-seq
MIRT2072367	hsa-miR-3201	CLIP-seq
MIRT2072368	hsa-miR-3619-5p	CLIP-seq
MIRT1244678	hsa-miR-3678-3p	CLIP-seq
MIRT2072369	hsa-miR-4267	CLIP-seq
MIRT2072370	hsa-miR-4291	CLIP-seq
MIRT1244682	hsa-miR-4323	CLIP-seq
MIRT2072371	hsa-miR-4450	CLIP-seq
MIRT2072372	hsa-miR-4667-5p	CLIP-seq
MIRT1244686	hsa-miR-4690-3p	CLIP-seq
MIRT2072373	hsa-miR-4690-5p	CLIP-seq
MIRT2072374	hsa-miR-4700-5p	CLIP-seq
MIRT2072375	hsa-miR-4736	CLIP-seq
MIRT1244691	hsa-miR-4758-3p	CLIP-seq
MIRT2072376	hsa-miR-4763-3p	CLIP-seq
MIRT2072377	hsa-miR-4791	CLIP-seq
MIRT2072378	hsa-miR-761	CLIP-seq
MIRT2072379	hsa-miR-922	CLIP-seq
MIRT2072363	hsa-miR-1207-5p	CLIP-seq
MIRT2072365	hsa-miR-183	CLIP-seq
MIRT2299546	hsa-miR-3074-5p	CLIP-seq
MIRT2072367	hsa-miR-3201	CLIP-seq
MIRT2299547	hsa-miR-3662	CLIP-seq
MIRT2299548	hsa-miR-3925-3p	CLIP-seq
MIRT2299549	hsa-miR-4257	CLIP-seq
MIRT2299550	hsa-miR-4312	CLIP-seq
MIRT2072371	hsa-miR-4450	CLIP-seq
MIRT2072372	hsa-miR-4667-5p	CLIP-seq
MIRT2072374	hsa-miR-4700-5p	CLIP-seq
MIRT2299551	hsa-miR-4722-3p	CLIP-seq
MIRT2072375	hsa-miR-4736	CLIP-seq
MIRT2072376	hsa-miR-4763-3p	CLIP-seq
MIRT2072377	hsa-miR-4791	CLIP-seq
MIRT2299552	hsa-miR-498	CLIP-seq
MIRT2299553	hsa-miR-520a-5p	CLIP-seq
MIRT2299554	hsa-miR-525-5p	CLIP-seq
MIRT2299555	hsa-miR-766	CLIP-seq
MIRT2072363	hsa-miR-1207-5p	CLIP-seq
MIRT2596253	hsa-miR-1289	CLIP-seq
MIRT2072365	hsa-miR-183	CLIP-seq
MIRT2596254	hsa-miR-2355-5p	CLIP-seq
MIRT2299546	hsa-miR-3074-5p	CLIP-seq
MIRT2596255	hsa-miR-3121-5p	CLIP-seq
MIRT1244677	hsa-miR-3140-5p	CLIP-seq
MIRT2596256	hsa-miR-3157-3p	CLIP-seq
MIRT2596257	hsa-miR-3198	CLIP-seq
MIRT2072367	hsa-miR-3201	CLIP-seq
MIRT2299547	hsa-miR-3662	CLIP-seq
MIRT2299548	hsa-miR-3925-3p	CLIP-seq
MIRT2299549	hsa-miR-4257	CLIP-seq
MIRT1244681	hsa-miR-4279	CLIP-seq
MIRT2596258	hsa-miR-4294	CLIP-seq
MIRT2596259	hsa-miR-4309	CLIP-seq
MIRT2299550	hsa-miR-4312	CLIP-seq
MIRT2596260	hsa-miR-432	CLIP-seq
MIRT2596261	hsa-miR-4434	CLIP-seq
MIRT2072371	hsa-miR-4450	CLIP-seq
MIRT2596262	hsa-miR-4516	CLIP-seq
MIRT2596263	hsa-miR-4531	CLIP-seq
MIRT2596264	hsa-miR-4667-3p	CLIP-seq
MIRT2072372	hsa-miR-4667-5p	CLIP-seq
MIRT1244685	hsa-miR-4687-3p	CLIP-seq
MIRT2072374	hsa-miR-4700-5p	CLIP-seq
MIRT1244688	hsa-miR-4709-3p	CLIP-seq
MIRT2299551	hsa-miR-4722-3p	CLIP-seq
MIRT2072375	hsa-miR-4736	CLIP-seq
MIRT2072376	hsa-miR-4763-3p	CLIP-seq
MIRT2072377	hsa-miR-4791	CLIP-seq
MIRT2299552	hsa-miR-498	CLIP-seq
MIRT2299553	hsa-miR-520a-5p	CLIP-seq
MIRT2299554	hsa-miR-525-5p	CLIP-seq
MIRT1244695	hsa-miR-626	CLIP-seq
MIRT2299555	hsa-miR-766	CLIP-seq
MIRT2596265	hsa-miR-874	CLIP-seq
MIRT2596266	hsa-miR-938	CLIP-seq
MIRT2072363	hsa-miR-1207-5p	CLIP-seq
MIRT2596253	hsa-miR-1289	CLIP-seq
MIRT2072365	hsa-miR-183	CLIP-seq
MIRT2596254	hsa-miR-2355-5p	CLIP-seq
MIRT2596255	hsa-miR-3121-5p	CLIP-seq
MIRT1244677	hsa-miR-3140-5p	CLIP-seq
MIRT2596256	hsa-miR-3157-3p	CLIP-seq
MIRT2596257	hsa-miR-3198	CLIP-seq
MIRT2072367	hsa-miR-3201	CLIP-seq
MIRT2299547	hsa-miR-3662	CLIP-seq
MIRT2299548	hsa-miR-3925-3p	CLIP-seq
MIRT2299549	hsa-miR-4257	CLIP-seq
MIRT1244681	hsa-miR-4279	CLIP-seq
MIRT2596258	hsa-miR-4294	CLIP-seq
MIRT2596259	hsa-miR-4309	CLIP-seq
MIRT2596260	hsa-miR-432	CLIP-seq
MIRT2596261	hsa-miR-4434	CLIP-seq
MIRT2072371	hsa-miR-4450	CLIP-seq
MIRT2596262	hsa-miR-4516	CLIP-seq
MIRT2596263	hsa-miR-4531	CLIP-seq
MIRT2596264	hsa-miR-4667-3p	CLIP-seq
MIRT2072372	hsa-miR-4667-5p	CLIP-seq
MIRT1244685	hsa-miR-4687-3p	CLIP-seq
MIRT2072374	hsa-miR-4700-5p	CLIP-seq
MIRT1244688	hsa-miR-4709-3p	CLIP-seq
MIRT2072375	hsa-miR-4736	CLIP-seq
MIRT2072376	hsa-miR-4763-3p	CLIP-seq
MIRT2072377	hsa-miR-4791	CLIP-seq
MIRT2299552	hsa-miR-498	CLIP-seq
MIRT2299553	hsa-miR-520a-5p	CLIP-seq
MIRT2299554	hsa-miR-525-5p	CLIP-seq
MIRT1244695	hsa-miR-626	CLIP-seq
MIRT2299555	hsa-miR-766	CLIP-seq
MIRT2596265	hsa-miR-874	CLIP-seq
MIRT2596266	hsa-miR-938	CLIP-seq

Gene ontology (GO) Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004631	Function	Phosphomevalonate kinase activity	IBA
GO:0004631	Function	Phosphomevalonate kinase activity	IDA	8663599, 14680974, 16519518
GO:0004631	Function	Phosphomevalonate kinase activity	IEA
GO:0004631	Function	Phosphomevalonate kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005524	Function	ATP binding	IDA	16519518
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005777	Component	Peroxisome	IDA	14729858
GO:0005777	Component	Peroxisome	IDA	17180682
GO:0005829	Component	Cytosol	IDA	14729858, 27052676
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006694	Process	Steroid biosynthetic process	IEA
GO:0006695	Process	Cholesterol biosynthetic process	IBA
GO:0006695	Process	Cholesterol biosynthetic process	IDA	8663599
GO:0006695	Process	Cholesterol biosynthetic process	IEA
GO:0006695	Process	Cholesterol biosynthetic process	TAS
GO:0008202	Process	Steroid metabolic process	IEA
GO:0008203	Process	Cholesterol metabolic process	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016126	Process	Sterol biosynthetic process	IDA	16519518
GO:0016126	Process	Sterol biosynthetic process	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019287	Process	Isopentenyl diphosphate biosynthetic process, mevalonate pathway	IBA
GO:0019287	Process	Isopentenyl diphosphate biosynthetic process, mevalonate pathway	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070723	Process	Response to cholesterol	IEP	10191291

Other IDs

• MIM: 607622
• HGNC: 9141
• e!Ensembl: ENSG00000163344

Protein

• UniProt ID: Q15126
• Protein name: Phosphomevalonate kinase (PMKase) (hPMK) (EC 2.7.4.2)
• Protein function: Catalyzes the reversible ATP-dependent phosphorylation of mevalonate 5-phosphate to produce mevalonate diphosphate and ADP, a key step in the mevalonic acid mediated biosynthesis of isopentenyl diphosphate and other polyisoprenoid metabolites. {
• PDB: 3CH4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04275	P-mevalo_kinase	14 → 124	Phosphomevalonate kinase	Family

• Tissue specificity: TISSUE SPECIFICITY: Heart, liver, skeletal muscle, kidney, and pancreas. Lower level in brain, placenta and lung. {ECO:0000269|PubMed:8663599}.
• Sequence:

  MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQ
  RLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFRE
  AYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQ
  LENLIEFIRSRL

• Sequence length: 192

Pathways

KEGG Pathway	Reactome Pathway
Terpenoid backbone biosynthesis	Cholesterol biosynthesis
Metabolic pathways	Activation of gene expression by SREBF (SREBP)
Peroxisome

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Linear porokeratosis	Likely pathogenic; Pathogenic	rs373000976, rs140728783, rs2101965598	RCV001849504 RCV001849670 RCV001849672	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
PMVK-related disorder	Likely pathogenic; Pathogenic	rs373000976	RCV003399087	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Porokeratosis 1, Mibelli type	Likely pathogenic; Pathogenic	rs373000976, rs745983207, rs879255607	RCV003135955 RCV004576932 RCV004576933	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (16)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	28416818, 29892015, 30061737, 34594039, 35872910, 36653681, 39537608	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOINFLAMMATORY SYNDROME	—	Disgenet, GenCC Disgenet, GenCC	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	31043756	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC EMBOLISM	—	GWAS catalog	34031191	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOEMBOLIC STROKE	—	GWAS catalog	34031191, 35872910	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	GWAS catalog	36266505	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	40205036	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	24842889, 31701892, 37842648, 38155330	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PMVK-associated autoinflammatory disorder	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POROKERATOSIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POROKERATOSIS 1, MULTIPLE TYPE S	—	CTD, HPO CTD, HPO	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POROKERATOSIS OF MIBELLI	—	Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet	26202976, 26202976	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POROKERATOSIS, DISSEMINATED SUPERFICIAL ACTINIC	—	Disgenet	41296516,27052676,26202976,37315547	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	26198764, 35396580	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (20)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Atrial Fibrillation	Atrial fibrillation	Pubtator	37581400	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cataract	Cataract	BEFREE	15544330		★☆☆☆☆ Found in Text Mining only
Deficiency of galactokinase	Deficiency Of Galactokinase	BEFREE	15544330		★☆☆☆☆ Found in Text Mining only
Deficiency of mevalonate kinase	Deficiency Of Mevalonate Kinase	BEFREE	9647750		★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Parakeratosis	Parakeratosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Porokeratosis	Porokeratosis	Pubtator	26202976, 27052676, 30942823, 35853659, 37315547	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Porokeratosis	Porokeratosis	BEFREE	28765912		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Porokeratosis	Porokeratosis	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Porokeratosis of Mibelli	Porokeratosis	ORPHANET_DG	26202976		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Porokeratosis of Mibelli	Porokeratosis	UNIPROT_DG	26202976, 27052676		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Porokeratosis of Mibelli	Porokeratosis	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Porokeratosis of Mibelli	Porokeratosis	GENOMICS_ENGLAND_DG	27052676		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Porokeratosis of Mibelli	Porokeratosis	BEFREE	28765912		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Porokeratosis of Mibelli	Porokeratosis	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Porokeratosis of Mibelli	Porokeratosis	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Porokeratosis, Linear	Porokeratosis	GENOMICS_ENGLAND_DG	30942823		★☆☆☆☆ Found in Text Mining only
Porokeratosis, Linear	Porokeratosis	BEFREE	30942823		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	38158702	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

MVK 2 shared diseasesAutoinflammatory syndrome, Porokeratosis 4 shared pathwaysTerpenoid backbone biosynthesis, Peroxisome, Activation of gene expression by SREBF (SREBP), Cholesterol biosynthesis 7 shared evidence sourcesDisgenet (Autoinflammatory syndrome), Disgenet (Porokeratosis), ClinVar (Porokeratosis), GWAS catalog (Porokeratosis), CTD (Porokeratosis), HPO (Porokeratosis), Orphanet (Porokeratosis) Related via 4 shared pathways including Terpenoid backbone biosynthesis, Peroxisome — evidence mostly Disgenet. MIDEAS 2 shared diseasesCardiac embolism, Cardioembolic stroke 2 shared evidence sourcesGWAS catalog (Cardiac embolism), GWAS catalog (Cardioembolic stroke) Related via 2 shared diseases including Cardiac embolism, Cardioembolic stroke — evidence mostly GWAS catalog. NRN1 2 shared diseasesCardiac embolism, Cardioembolic stroke 2 shared evidence sourcesGWAS catalog (Cardiac embolism), GWAS catalog (Cardioembolic stroke) Related via 2 shared diseases including Cardiac embolism, Cardioembolic stroke — evidence mostly GWAS catalog. OR4D1 2 shared diseasesCardiac embolism, Cardioembolic stroke 2 shared evidence sourcesGWAS catalog (Cardiac embolism), GWAS catalog (Cardioembolic stroke) Related via 2 shared diseases including Cardiac embolism, Cardioembolic stroke — evidence mostly GWAS catalog. OR4D2 2 shared diseasesCardiac embolism, Cardioembolic stroke 2 shared evidence sourcesGWAS catalog (Cardiac embolism), GWAS catalog (Cardioembolic stroke) Related via 2 shared diseases including Cardiac embolism, Cardioembolic stroke — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
MVK	2	["Autoinflammatory syndrome","Porokeratosis"]	4	["Terpenoid backbone biosynthesis","Peroxisome","Activation of gene expression by SREBF (SREBP)","Cholesterol biosynthesis"]	7	["Disgenet (Autoinflammatory syndrome)","Disgenet (Porokeratosis)","ClinVar (Porokeratosis)","GWAS catalog (Porokeratosis)","CTD (Porokeratosis)","HPO (Porokeratosis)","Orphanet (Porokeratosis)"]
MIDEAS	2	["Cardiac embolism","Cardioembolic stroke"]	0	[]	2	["GWAS catalog (Cardiac embolism)","GWAS catalog (Cardioembolic stroke)"]
NRN1	2	["Cardiac embolism","Cardioembolic stroke"]	0	[]	2	["GWAS catalog (Cardiac embolism)","GWAS catalog (Cardioembolic stroke)"]
OR4D1	2	["Cardiac embolism","Cardioembolic stroke"]	0	[]	2	["GWAS catalog (Cardiac embolism)","GWAS catalog (Cardioembolic stroke)"]
OR4D2	2	["Cardiac embolism","Cardioembolic stroke"]	0	[]	2	["GWAS catalog (Cardiac embolism)","GWAS catalog (Cardioembolic stroke)"]

Diseases Linked via Similar Genes

Dementia Linked via 2 of 5 related genesOR4D1, OR4D2 Alzheimer disease Linked via 1 of 5 related genesMVK Arthralgia Linked via 1 of 5 related genesMVK Hepatocellular carcinoma Linked via 1 of 5 related genesMVK Cataract Linked via 1 of 5 related genesMVK

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Dementia	2	["OR4D1","OR4D2"]
Alzheimer disease	1	["MVK"]
Arthralgia	1	["MVK"]
Hepatocellular carcinoma	1	["MVK"]
Cataract	1	["MVK"]