PLK3 (polo like kinase 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 1263
• Gene name: Polo like kinase 3
• Gene symbol: PLK3
• Synonyms (NCBI Gene): CNK, FNK, PLK-3, PRK
• Chromosome: 1
• Chromosome location: 1p34.1
• Summary: The protein encoded by this gene is a member of the highly conserved polo-like kinase family of serine/threonine kinases. Members of this family are characterized by an amino-terminal kinase domain and a carboxy-terminal bipartite polo box domain that fun

miRNA Show/Hide all (33)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017129	hsa-miR-335-5p	Microarray	18185580
MIRT1242946	hsa-miR-3179	CLIP-seq
MIRT1242947	hsa-miR-3202	CLIP-seq
MIRT1242948	hsa-miR-3660	CLIP-seq
MIRT1242949	hsa-miR-4271	CLIP-seq
MIRT1242950	hsa-miR-4476	CLIP-seq
MIRT1242951	hsa-miR-4493	CLIP-seq
MIRT1242952	hsa-miR-4526	CLIP-seq
MIRT1242953	hsa-miR-4716-3p	CLIP-seq
MIRT1242954	hsa-miR-4717-5p	CLIP-seq
MIRT1242955	hsa-miR-4725-3p	CLIP-seq
MIRT1242956	hsa-miR-4747-5p	CLIP-seq
MIRT1242957	hsa-miR-4753-5p	CLIP-seq
MIRT1242958	hsa-miR-4796-3p	CLIP-seq
MIRT1242959	hsa-miR-548n	CLIP-seq
MIRT1242960	hsa-miR-548t	CLIP-seq
MIRT1242961	hsa-miR-595	CLIP-seq
MIRT1242962	hsa-miR-625	CLIP-seq
MIRT2595748	hsa-miR-24	CLIP-seq
MIRT2595749	hsa-miR-3155	CLIP-seq
MIRT2595750	hsa-miR-3155b	CLIP-seq
MIRT2595751	hsa-miR-3192	CLIP-seq
MIRT2595752	hsa-miR-3545-5p	CLIP-seq
MIRT2595753	hsa-miR-4300	CLIP-seq
MIRT2595754	hsa-miR-4313	CLIP-seq
MIRT2595755	hsa-miR-4633-3p	CLIP-seq
MIRT1242958	hsa-miR-4796-3p	CLIP-seq
MIRT2595756	hsa-miR-484	CLIP-seq
MIRT1242959	hsa-miR-548n	CLIP-seq
MIRT1242960	hsa-miR-548t	CLIP-seq
MIRT2595757	hsa-miR-610	CLIP-seq
MIRT2595758	hsa-miR-614	CLIP-seq
MIRT2595759	hsa-miR-920	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
TP53	Unknown	16581545

Gene ontology (GO) Show/Hide all (67)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IEA
GO:0000082	Process	G1/S transition of mitotic cell cycle	IMP	17264206
GO:0000086	Process	G2/M transition of mitotic cell cycle	TAS	16481012
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	19490146
GO:0000166	Function	Nucleotide binding	IEA
GO:0000302	Process	Response to reactive oxygen species	IDA	11447225
GO:0000776	Component	Kinetochore	IBA
GO:0000922	Component	Spindle pole	IBA
GO:0002039	Function	P53 binding	IDA	11447225
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	11447225, 14968113, 16481012, 19103756, 20889502, 21098032, 21376736, 21840391
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	8702627
GO:0005515	Function	Protein binding	IPI	14968113, 14980500, 16481012, 18482256, 19103756, 19490146, 20889502, 20951827, 21098032, 21264284, 21376736, 21840391, 25416956, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	19490146, 21098032
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA	17264206
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	19490146
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005795	Component	Golgi stack	IDA	14980500
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	16478733, 20951827
GO:0005813	Component	Centrosome	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006468	Process	Protein phosphorylation	TAS	8702627
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	16478733
GO:0006970	Process	Response to osmotic stress	IDA	21098032
GO:0006974	Process	DNA damage response	IBA
GO:0006974	Process	DNA damage response	IDA	19490146
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IMP	16481012
GO:0007052	Process	Mitotic spindle organization	IBA
GO:0007113	Process	Endomitotic cell cycle	TAS	21264284
GO:0009314	Process	Response to radiation	IDA	21376736
GO:0010508	Process	Positive regulation of autophagy	IEA
GO:0010564	Process	Regulation of cell cycle process	IEA
GO:0010646	Process	Regulation of cell communication	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0023051	Process	Regulation of signaling	IEA
GO:0030330	Process	DNA damage response, signal transduction by p53 class mediator	TAS
GO:0030425	Component	Dendrite	IEA
GO:0031122	Process	Cytoplasmic microtubule organization	IMP	20951827
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	20889502
GO:0032465	Process	Regulation of cytokinesis	IMP	16478733
GO:0032465	Process	Regulation of cytokinesis	TAS	21840391
GO:0043025	Component	Neuronal cell body	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	19490146
GO:0044819	Process	Mitotic G1/S transition checkpoint signaling	IBA
GO:0044819	Process	Mitotic G1/S transition checkpoint signaling	ISS
GO:0045732	Process	Positive regulation of protein catabolic process	IEA
GO:0051302	Process	Regulation of cell division	IDA	20951827
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0090166	Process	Golgi disassembly	IBA
GO:0090166	Process	Golgi disassembly	IDA	14980500, 19103756
GO:0090316	Process	Positive regulation of intracellular protein transport	IMP	20951827
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS
GO:1904716	Process	Positive regulation of chaperone-mediated autophagy	IDA	27344333

Other IDs

• MIM: 602913
• HGNC: 2154
• e!Ensembl: ENSG00000173846

Protein

• UniProt ID: Q9H4B4
• Protein name: Serine/threonine-protein kinase PLK3 (EC 2.7.11.21) (Cytokine-inducible serine/threonine-protein kinase) (FGF-inducible kinase) (Polo-like kinase 3) (PLK-3) (Proliferation-related kinase)
• Protein function: Serine/threonine-protein kinase involved in cell cycle regulation, response to stress and Golgi disassembly. Polo-like kinases act by binding and phosphorylating proteins that are already phosphorylated on a specific motif recognized by the POLO
• PDB: 4B6L
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00659	POLO_box	568 → 636	POLO box duplicated region	Family
  PF00659	POLO_box	471 → 532	POLO box duplicated region	Family
  PF00069	Pkinase	62 → 314	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Transcripts are highly detected in placenta, lung, followed by skeletal muscle, heart, pancreas, ovaries and kidney and weakly detected in liver and brain. May have a short half-live. In cells of hematopoietic origin, strongly and excl
• Sequence:

  MEPAAGFLSPRPFQRAAAAPAPPAGPGPPPSALRGPELEMLAGLPTSDPGRLITDPRSGR
  TYLKGRLLGKGGFARCYEATDTETGSAYAVKVIPQSRVAKPHQREKILNEIELHRDLQHR
  HIVRFSHHFEDADNIYIFLELCSRKSLAHIWKARHTLLEPEVRYYLRQILSGLKYLHQRG
  ILHRDLKLGNFFITENMELKVGDFGLAARLEPPEQRKKTICGTPNYVAPEVLLRQGHGPE
  ADVWSLGCVMYTLLCGSPPFETADLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPR
  DRPSIDQILRHDFFTKGYTPDRLPISSCVTVPDLTPPNPARSLFAKVTKSLFGRKKKSKN
  HAQERDEVSGLVSGLMRTSVGHQDARPEAPAASGPAPVSLVETAPEDSSPRGTLASSGDG
  FEEGLTVATVVESALCALRNCIAFMPPAEQNPAPLAQPEPLVWVSKWVDYSNKFGFGYQL
  SSRRVAVLFNDGTHMALSANRKTVHYNPTSTKHFSFSVGAVPRALQPQLGILRYFASYME
  QHLMKGGDLPSVEEVEVPAPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEP
  LLVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYALRLLRDRSPA

• Sequence length: 646

Pathways

KEGG Pathway	Reactome Pathway
FoxO signaling pathway	TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain
C-type lectin receptor signaling pathway	Regulation of TP53 Activity through Phosphorylation
Tuberculosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (44)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alopecia	Alopecia	BEFREE	18164732		★☆☆☆☆ Found in Text Mining only
Anus Neoplasms	Anus neoplasm	Pubtator	27325299, 27462786	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	25659073	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20473878		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20473878	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	16160013	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	16160013		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28515325	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10679924		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11746980		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34080290	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	25818805		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31655629		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	25818805		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	8603636		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35256538	Stimulate	★☆☆☆☆ Found in Text Mining only
Granular Dystrophy, Corneal	Corneal Granular Dystrophy	BEFREE	28377594		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	10679924		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	16868416		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28515325	Inhibit	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	29403662, 31169612, 31393985		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20112253		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	11746980		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28475299, 34080290	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	16868416		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	10679924		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20473878		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11746980		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12514133, 30863161		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26384350		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17989776, 27423313, 31655629		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	29327327	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	27387891	Associate	★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	29340891		★☆☆☆☆ Found in Text Mining only
Myopic astigmatism	Myopic astigmatism	BEFREE	29340891		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10679924, 14970859, 25818805, 27423313, 28857653, 31475104, 31655629, 8702627		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28854271, 30240960		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	14970859	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12514133, 30863161		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12514133, 28108419	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	25165096		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28854271		★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	BEFREE	27699605, 27941045, 30809386		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26384350		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

LSP1 2 shared pathwaysC-type lectin receptor signaling pathway, Tuberculosis Related via 2 shared pathways including C-type lectin receptor signaling pathway, Tuberculosis. PLK2 2 shared pathwaysFoxO signaling pathway, TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain Related via 2 shared pathways including FoxO signaling pathway, TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain. CLEC4E 2 shared pathwaysC-type lectin receptor signaling pathway, Tuberculosis Related via 2 shared pathways including C-type lectin receptor signaling pathway, Tuberculosis. CARD9 2 shared pathwaysC-type lectin receptor signaling pathway, Tuberculosis Related via 2 shared pathways including C-type lectin receptor signaling pathway, Tuberculosis. CLEC7A 2 shared pathwaysC-type lectin receptor signaling pathway, Tuberculosis Related via 2 shared pathways including C-type lectin receptor signaling pathway, Tuberculosis.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
LSP1	0	[]	2	["C-type lectin receptor signaling pathway","Tuberculosis"]	0	[]
PLK2	0	[]	2	["FoxO signaling pathway","TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain"]	0	[]
CLEC4E	0	[]	2	["C-type lectin receptor signaling pathway","Tuberculosis"]	0	[]
CARD9	0	[]	2	["C-type lectin receptor signaling pathway","Tuberculosis"]	0	[]
CLEC7A	0	[]	2	["C-type lectin receptor signaling pathway","Tuberculosis"]	0	[]

Diseases Linked via Similar Genes

Breast cancer Linked via 2 of 5 related genesLSP1, PLK2 Ulcerative colitis Linked via 2 of 5 related genesLSP1, CARD9 Crohn disease Linked via 2 of 5 related genesLSP1, CARD9 Hypertension Linked via 2 of 5 related genesLSP1, PLK2 Inflammatory bowel disease Linked via 2 of 5 related genesLSP1, CARD9

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Breast cancer	2	["LSP1","PLK2"]
Ulcerative colitis	2	["LSP1","CARD9"]
Crohn disease	2	["LSP1","CARD9"]
Hypertension	2	["LSP1","PLK2"]
Inflammatory bowel disease	2	["LSP1","CARD9"]